KEGG   Desulfobacterium autotrophicum: HRM2_47210Help
Entry
HRM2_47210        CDS       T00861                                 

Gene name
acsM4
Definition
(GenBank) AcsM4
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00010  Glycolysis / Gluconeogenesis
dat00620  Pyruvate metabolism
dat00640  Propanoate metabolism
dat00680  Methane metabolism
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
dat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_47210 (acsM4)
   00620 Pyruvate metabolism
    HRM2_47210 (acsM4)
   00640 Propanoate metabolism
    HRM2_47210 (acsM4)
  Energy metabolism
   00680 Methane metabolism
    HRM2_47210 (acsM4)
Enzymes [BR:dat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HRM2_47210 (acsM4)
Lipid biosynthesis proteins [BR:dat01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HRM2_47210 (acsM4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACN17770
UniProt: C0QHB1
Position
complement(5322777..5324543)
Genome map
AA seq 588 aa AA seqDB search
MGWQTITKTKGHHRVQPNLLDYDAACADFSWENISSELSGLPDGRGFNIAHEAVDRHANG
PLRNHLAIRWLGDNGTVLDFTYRDLQEQSNRFANLLCRLGLDKGECVSVLTGRIPQLYIA
VFGTLKALGVVCPLFAAFGPEPIFQRLERGKVKILVTTWDLYRKKVAGLSARLPELQHIL
IVDQADDPGDGLWSMPRLMNEASSEFTIPATDLEDRAVLHFTSGTTGMAKGAIHVHNAVL
IHYMTGRYVMDFHPGDIFWCTADPGWVTGTSYGIIAPLLHGITNIVDEADFDAGRWYRIL
DRERVSVWYTAPTAIRRLMRMGTEPREQFNLTHLRLIHSVGEPLNPEAVVWGRDVLGLPV
HDNWWQTETGGIMIANFASMDIYPGSMGRPLPGIEVAIVSRVAENRVQVLGVRNVEGELA
IKPGWPSMFRGYINDEERYHKCFLDGWYLTGDLAKCDDHGYYWFIGRGDDIIKTSGHMVG
PFEVESALMEHPAVAEAGVIGKPDPLTGEMVKAFVCLKPGFEPNDELCRQLIGFARRLLG
PTIAPREIEFNNHLPKNRAGKIMRRLLKARELGLPEGDISTLETENEE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggttggcaaacgataacgaaaacaaaggggcatcaccgggttcaacccaatctcctt
gattatgatgccgcctgtgctgatttttcctgggaaaatatttccagcgagttgagtggg
ttgccagatggcaggggatttaatattgcccatgaagcggtagatcgccatgcaaacgga
ccgcttcggaaccatctggccatccggtggctgggagacaacggcacggtcctggatttt
acatacagggatctgcaggagcaaagcaatcgtttcgccaatcttctgtgccggctcggg
ctggacaagggcgagtgtgtatccgtgctcacagggcgcataccccagttgtatattgct
gtgttcggaactttaaaagcattgggagttgtctgtcctctgtttgccgcctttggtccg
gaaccgatcttccagcggctggaacgaggaaaggtgaagattctggtgaccacctgggac
ttatatcgaaaaaaagtggcaggcttaagcgcccggctgccggaattacagcatattctc
atcgttgatcaggcggatgacccgggagacggtctctggtcaatgcccaggctaatgaac
gaagcctccagcgaattcacgattccggcaacggatcttgaggacagggctgtcctgcat
tttacaagcggcaccaccggcatggccaagggggccatccacgtgcacaatgcagtcctt
atccactatatgacaggcaggtatgtgatggattttcaccccggggatatcttctggtgt
acagcagatcccgggtgggtaaccggaacatcctacggcattatcgccccgctgctccat
gggattaccaatattgttgacgaagccgactttgatgccgggcgctggtatcgaatttta
gaccgggaacgagtaagcgtctggtacacggcgcccacggcaatccgaaggctgatgcgc
atgggcacggaaccccgcgagcaatttaatctgacccaccttcgattgatccacagcgtg
ggtgagccccttaatccggaagccgttgtatggggtcgggatgttctggggctgcctgtc
catgataactggtggcagactgaaaccggagggatcatgattgccaattttgcctccatg
gacatttatccgggctccatgggtcggccactgccggggatcgaggtggccatcgtttcc
agggtggctgaaaacagggtccaggtcctgggggttcggaatgtggaaggggaactggcc
attaagcctggctggccatccatgttcagggggtatatcaatgatgaggaacgctaccat
aaatgtttcctggacgggtggtatctcaccggtgatctggcaaaatgcgatgaccatggt
tattactggtttatcggtcgaggggacgacatcatcaagacatccggtcacatggttggc
ccctttgaagtggaaagcgccctgatggaacatcctgctgtggccgaagccggggtgatc
ggtaaacctgacccgctgactggagaaatggtcaaggcctttgtctgcctcaaacccggg
ttcgaacccaatgacgaactttgcagacaactgatcgggttcgcccgacgcctgctcggg
ccgaccattgcccccagggaaattgagtttaacaaccatcttcccaaaaacagggctggc
aaaatcatgcggcgccttctcaaggcacgcgaacttggcctgcctgaaggggatatttcc
acgttggagacagaaaacgaggaataa

DBGET integrated database retrieval system