KEGG   Desulfobacterium autotrophicum: HRM2_47710Help
Entry
HRM2_47710        CDS       T00861                                 

Gene name
nudC
Definition
(GenBank) NudC
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00760  Nicotinate and nicotinamide metabolism
dat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HRM2_47710 (nudC)
Enzymes [BR:dat01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     HRM2_47710 (nudC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase Nudix_N_2 zf-C3HC4 NUDIX-like DZR Auto_anti-p27 zf-RING_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_5 zf-C3HC4_2
Motif
Other DBs
NCBI-ProteinID: ACN17820
UniProt: C0QHG1
Position
complement(5381181..5381984)
Genome map
AA seq 267 aa AA seqDB search
MESSKMEDMTQRAKGLAFVFDKDRLVLLVDGPLLRLPLVGELSLPRQGRWFGTHQRLDCF
VSELPKGFPLPLSAQLLGLRQLFGQIDDSLYVLAGRAVQILTWDLGHRFCSACATPLVDK
QREVAKICPACSVISYPRLSPAVIMTVERGHEILLGRSPRFPRGMYSTLAGFVEPGETLE
QAVRREVKEEVGVLLEEVRYFGSQPWPFPHSLMVGFNAEYAGGEIVPDPTEIEDARWFSR
DALPKLPSRISIARKLIDNFLARTRPD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcagcaaaatggaagatatgacacaaagggcgaagggccttgcttttgtcttt
gataaggaccgtctggtcctcctggtagatggcccgctactgcgcctcccccttgtggga
gaactttcattgccgagacagggacgctggtttgggacccatcaacgcctggactgcttt
gtcagcgagcttcccaaggggttcccccttcccctatctgcacagcttctgggccttcgc
cagctctttggccagattgatgattccctctacgtcctggccggtcgggccgttcagatt
ctgacctgggacctgggtcatcgattctgcagcgcctgcgcaactcccctggtggacaaa
caacgggaggtcgccaagatctgccccgcatgcagtgtcatcagttaccccaggctctct
cctgccgtgatcatgaccgttgaacggggccatgagattctcctgggccgttccccccgt
tttcccagggggatgtactccaccctggcaggctttgtggaaccgggggagaccctggag
caggcggttcggcgggaggttaaagaggaggtgggtgtccttttggaagaggtcaggtac
tttggcagccagccctggccctttccccactcgctgatggtgggcttcaatgcagaatat
gccgggggcgaaatcgtcccggatcccacggagatcgaggatgcccgctggttttcaagg
gatgccctgccaaaactgccctcccgcatcagcattgccagaaaactcatcgacaacttt
ctggcacgaacccgaccggactga

DBGET integrated database retrieval system