KEGG   Candidatus Desulforudis audaxviator: Daud_0089Help
Entry
Daud_0089         CDS       T00655                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00670  One carbon pool by folate
dau00720  Carbon fixation pathways in prokaryotes
dau01100  Metabolic pathways
dau01120  Microbial metabolism in diverse environments
dau01200  Carbon metabolism
Module
dau_M00140  C1-unit interconversion, prokaryotes
dau_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
Brite
KEGG Orthology (KO) [BR:dau00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Daud_0089
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Daud_0089
Enzymes [BR:dau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Daud_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ACA58657
UniProt: B1I1P5
Position
92094..93794
Genome map
AA seq 566 aa AA seqDB search
MTFRTDLEIAQAHQMIPITDLAASIGLSEEDIDLYGRYKAKIGLHVLEKFKERPAGRLID
VTAVTPTPLGEGKTLTTIGLTQGLGRIGKRAACTLRQPSMGPVFGIKGGAAGGGYAQVVP
MEDLNLHFTGDIHAVGQAHNLLAAMLDASLYHGNPHDIDLHTITWTRVMDVNDRALRDVV
VGLGGPVNGYPREAAFEATTASEVMAVLALADGIQNLRQRLGRIVVGFNRKGHPVTAEDL
QGAGAMAVILKEAVKPNLIQTLEGQPCIVHAGPFANIAHGQCSVLADRMALKLVDYVVTE
SGFGADLGMEKFMDIKCRQSGLRPDCVVVTCTIRSLKMHGGVGRIIPGKPLPEEIRRENP
AAVAEGCRNLAHMIKIAHYYGVPVVVAVNRFLEDTDAEVETVLREAVRAGALSAHPVTAW
AEGGAGAVDLAAGVVSACERGGEFRLLYPDELSIKEKIEVLARRVYNADEVAYEPLAEKK
IARFEELGWGRLPICMAKTHLSISHDPMLRNVPSGYVFPIRDIRVSLGAGFLYPLAGAML
TMPGLPSRPAAFGIDIDERGRVKGLF
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttaggacggacctggagatcgcccaggcgcaccagatgatacccattaccgat
ctggcagcttcaatcggcctgtcggaggaagacattgacctgtacgggcggtacaaggcc
aagatcggcctgcatgtactggaaaagttcaaggaacgaccggccggcagactgatcgac
gtcacggccgtcacccccacccctcttggcgaaggaaaaaccctgaccaccatcggattg
actcagggtctaggccggatcggtaaacgggcggcctgcaccctgcgccagccttccatg
ggcccggtgttcgggatcaaaggcggtgccgccgggggcgggtacgcccaagtggtgccc
atggaggaccttaatctgcatttcaccggcgacatccacgcggtggggcaggcccacaac
ctgctggccgccatgctcgacgcctcgctttatcacggcaacccgcacgatatcgacctg
cacacgatcacctggacacgagtcatggacgtgaacgaccgggccctgcgggacgtggtg
gtgggcctggggggaccggtcaacggctatccccgggaggctgcctttgaagcgacgacc
gcttcggaggtcatggccgttctcgcgcttgccgacggcatccagaacctgcgccagcgc
ctggggcggatagtggtgggcttcaaccgaaaaggccacccggtcacggccgaggacctt
cagggtgccggggcgatggcggtgattctcaaggaagcggtcaagcccaacctgattcag
acgctggagggacagccctgcatcgtgcacgccggaccgttcgccaacatcgcccacggg
cagtgttcggtgctggccgaccggatggcgttgaaactggtcgattacgtggtgaccgaa
agcgggttcggcgcggacctgggaatggaaaaattcatggacatcaagtgccggcagtcg
gggctccggcccgactgcgtggtggtcacctgcacgatacggtccctgaagatgcacggc
ggtgtcggccggatcatccccggcaagcccctgcccgaggagatcaggcgggagaacccg
gccgcggtcgcggaggggtgccgaaacctggcgcacatgatcaaaatcgcccactattac
ggggtgccggtggtggtcgccgtgaaccgtttcctcgaggatacggacgccgaggttgag
accgtgctccgggaggcggtgcgcgccggggccctgagcgcgcatccggtcaccgcctgg
gcggaaggcggggcgggagccgtcgacctcgccgccggtgttgtgtcggcctgcgagcgg
ggcggggagttccgcctgctttatccggatgaactgtcaatcaaggaaaaaatcgaggtg
ctcgcccggcgggtctacaacgcggacgaggtggcctacgagcccctggccgagaaaaag
atcgcccgcttcgaagaactgggctgggggcggctaccgatctgcatggccaagacgcac
ctgtccatctcccacgaccccatgctgcggaacgtaccttcggggtatgtgtttccgatc
cgggacatccgggtatcgctcggcgctgggtttttgtatcccttggccggggcgatgctt
accatgcccggcctgccctcccggcccgccgccttcgggattgatatcgacgagcgcgga
cgggtaaaggggctgttttga

DBGET integrated database retrieval system