KEGG   Candidatus Desulforudis audaxviator: Daud_0226
Entry
Daud_0226         CDS       T00655                                 

Definition
(GenBank) ribosomal protein L4/L1e
  KO
K02926  large subunit ribosomal protein L4
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dau00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Daud_0226
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dau03011]
    Daud_0226
Ribosome [BR:dau03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Daud_0226
  Bacteria
    Daud_0226
SSDB
Motif
Pfam: Ribosomal_L4 DLEU7
Other DBs
NCBI-ProteinID: ACA58787
UniProt: B1I1I9
Position
258380..259003
AA seq 207 aa
MPTAAVFNIEGQQVGEIELSEAVFGQPVNDAVLHEVVVMQLANRRQGTHDTKTRSEVRGG
GRKPWRQKGTGRARHGTIRSPIWRGGGIVFGPHPRDYSYRVPKKVKRLALKSALATKVDA
GRILVLDALELPGPKTKEMARILANLKAGEGALVVTAERNVNVEKSARNLPGVKSLEARQ
LNVYDLLNHPHLIITRDAVARVEEVLA
NT seq 624 nt   +upstreamnt  +downstreamnt
atgcccacagcagcagttttcaatatcgaaggtcaacaggtgggcgaaattgaactgagt
gaggccgtgttcggtcagccggtcaacgacgccgtactgcacgaagtggtcgtgatgcag
ttggccaaccggcggcagggcactcacgacaccaagacccggtccgaggtccggggaggc
gggaggaaaccctggcgccagaaaggcaccgggcgggcccgtcacgggaccatccgttcg
ccgatctggcgcgggggcggcatcgttttcggtcctcatccccgggattattcctaccgg
gtgcccaagaaggtcaagcggctggctttgaagtcggcgctggcgaccaaggtcgacgcg
ggccggatattggttctggacgccctggaactcccggggccgaagaccaaagagatggcg
cgcattctggccaacctgaaggccggagagggcgcgctggtggtgactgccgaaaggaac
gtcaacgtcgaaaagtcggcccggaaccttcccggggtgaaatccctggaggccaggcag
ctcaacgtgtacgacctgttgaaccatccccacctgatcataaccagggacgcggtggcc
cgggtggaggaggtgctggcgtaa

DBGET integrated database retrieval system