KEGG   Candidatus Desulforudis audaxviator: Daud_0343Help
Entry
Daud_0343         CDS       T00655                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00220  Arginine biosynthesis
dau01100  Metabolic pathways
dau01110  Biosynthesis of secondary metabolites
dau01130  Biosynthesis of antibiotics
dau01230  Biosynthesis of amino acids
Module
dau_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:dau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Daud_0343
Enzymes [BR:dau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Daud_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Root_cap
Motif
Other DBs
NCBI-ProteinID: ACA58901
UniProt: B1I1C9
Position
366577..367506
Genome map
AA seq 309 aa AA seqDB search
MTSLKGRDFLSILDFSVSELEAVFSLARDLKRKQRAGEAHPLCAGKTLAMIFQKPSTRTR
VSFEAGMFQLGGHALYLNAADLQLGRGETVADTARVLSRYVDGIMIRTFKQSDVEELAAH
AEVPVINGLTDWEHPCQILADFLTILEHKGRLAGLKLAYVGDGNNVAHSLLLGGARLGMR
VAVSSPRGYEPAPDLVSRAAAEAVRTGGAVELTTDPAAAVRDADVVVTDTWASMGRESEH
SARVKAFAPYQVNEALVAHARPDYIFMHCLPAHRGEEVVDAVMDGPRSVIWDEAENRLHV
QKALLALVL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgacgagccttaaagggcgcgactttctttccattctcgatttctccgtttcggagctg
gaggctgtcttcagcctggcccgcgacctgaagcgtaaacagcgggccggcgaggcccat
ccgctgtgcgccggcaaaaccctggcgatgatctttcagaagccctcgacccggacccgg
gtctccttcgaggccggcatgttccagctcggcgggcacgccctgtacctgaacgccgcc
gacctgcagctgggccgcggcgagacggtcgccgacaccgcccgggtgctttcccgctac
gtggacgggattatgatccggaccttcaagcagtccgacgtggaggaactggccgcccac
gccgaagtgccggtgatcaacggcctcaccgactgggaacacccgtgccagatcctggcc
gatttcctgaccatcctggaacacaagggccgcctggccgggctgaagctggcctacgtc
ggggacggaaacaatgtggcccactcgctccttttgggcggggcccgcctcgggatgcgg
gtggccgtatcctcgccccggggttacgagcccgcgccggacctggtgtcccgggccgcc
gccgaagcggtgcggaccggcggagccgtcgagctgacgaccgacccagccgccgccgtc
cgggacgccgacgtggtggtcaccgacacctgggcgtccatgggccgggagagtgagcac
agcgcccgggtcaaggcttttgccccgtaccaggtgaacgaggcgctggtcgcgcacgcg
cggccggattacatcttcatgcactgcctgccggcccaccggggcgaggaagtggtggac
gccgtcatggacggcccgcgcagcgtgatctgggacgaggccgaaaaccgcctgcacgtc
cagaaggcgctcctggccctggtgctctaa

DBGET integrated database retrieval system