KEGG   Candidatus Desulforudis audaxviator: Daud_1346Help
Entry
Daud_1346         CDS       T00655                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00860  Porphyrin and chlorophyll metabolism
dau01100  Metabolic pathways
dau01110  Biosynthesis of secondary metabolites
dau01120  Microbial metabolism in diverse environments
Module
dau_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Daud_1346
Enzymes [BR:dau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Daud_1346
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Daud_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase SH3_5
Motif
Other DBs
NCBI-ProteinID: ACA59855
UniProt: B1I4L7
Position
complement(1420949..1422484)
Genome map
AA seq 511 aa AA seqDB search
MPRGIVYLVGAGPGDAGLLTLKGLVCIQEADVVVYDRLVNSRILMHARPEAELVFAGKSP
EGHTLTQDAINGLLAARAGEGLTVARLKGGDPFVFGRGGEEAEYLAERGIPFEVVPGVTS
AVAAPAYAGIPLTHRDFTASVAVITGNEDPTKDETAIAWDKLSTGAGTIVFLMGMANLPD
IVARLVRHGRAGSTPVAVIRWGTLPEQETVEGTLDDIVERVRAAGLKNPAVIVVGEVCRM
RPHLRWFEQKPLFGRRILVTRSREQASALSERIARLGGEALEFPTIAIRPPDDYGPLDLA
ISEIDTYQWIVFTSVNGVDYFFNRFRELERDIRELGPARLCAIGPRTRDALVGRGLKVAY
IPEEYRAERIADGMGALLAPGERVLLPRADIAPSDLAEALTRAGAAVSDVTAYRTVAVGG
NAAPVRRLLAEGRVHAVTFTSSSTVRNFVGALGAEDLPSLLARSAVICIGPVTAQTAREL
GLKVAAVAREYTIDGLVQAVREYFGGSEGVA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcggcatagtgtacctggtcggggcgggcccgggtgacgccggcctgttgacc
ttgaaaggactagtctgcatccaggaggcggacgtggtggtgtacgaccgcctggtcaac
tcgcggatcctgatgcacgcccggccggaagccgaactggtttttgccgggaaatctccc
gaagggcacaccctgacgcaggacgcgattaacggcttactggccgccagggccggggaa
gggctgacggtggcccggctcaaagggggtgaccccttcgttttcggccgcggcggcgag
gaagccgagtacctggcggaacggggcattcctttcgaagtggtgcccggggtgacctcg
gcggtggcggcgcccgcgtacgcgggcatcccgctgacccaccgggatttcacggcctcg
gtggccgtgatcaccggcaatgaagaccccaccaaagacgaaaccgccattgcgtgggac
aaactaagcaccggggccggcaccatcgtgttcctgatgggtatggccaacctgcccgac
atcgtggcgcggcttgtccggcacggccgggccggatccaccccggtggccgtcatccgt
tgggggacgctgcccgagcaggaaacggtggagggcaccctggacgacatcgtggaacgg
gtccgggcagccgggctgaagaacccggccgtcattgtggtgggcgaggtgtgccggatg
cggccgcacctgcgctggttcgagcaaaagccgctcttcggccggcggattctggtcacc
cggtcgcgggagcaggccagcgcgctgtcggagcggatcgcccggctggggggcgaggct
ctggagtttccgaccatcgccatccgcccgccggacgactacggccctttggatctggcc
atcagtgaaattgacacctaccagtggatcgtgttcaccagtgtgaacggggtcgactat
ttcttcaaccgcttccgggaactggagcgggacatccgggaactcggcccggcgcggctc
tgcgccatcgggccgcgcaccagggatgcgctggtcggccgcggcctgaaggtggcctac
atcccggaggaataccgggccgagcggatcgcggacgggatgggcgcgcttttggccccc
ggggagcgggtcctgctgccccgggccgacatcgcgccgtccgacctggccgaggcgctg
acccgggcgggggcggccgtcagcgacgtcaccgcctaccgcacggtcgccgtgggcgga
aatgcggcccccgtgcgccggctgctcgccgaggggcgggtgcacgcggtgaccttcacc
agttcctcgacggtgcgcaatttcgtgggcgccctgggggcggaagacctccccagtttg
ttagcccggtcggcggtgatctgcatcgggccggtgaccgcgcaaacggcccgggagttg
ggcctcaaggtggcggcggtggcccgcgaatacacgatcgacggcctggttcaggccgtg
cgggagtacttcggtgggagtgaaggtgttgcttag

DBGET integrated database retrieval system