KEGG   Candidatus Desulforudis audaxviator: Daud_1572Help
Entry
Daud_1572         CDS       T00655                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00010  Glycolysis / Gluconeogenesis
dau00620  Pyruvate metabolism
dau00640  Propanoate metabolism
dau00680  Methane metabolism
dau00720  Carbon fixation pathways in prokaryotes
dau01100  Metabolic pathways
dau01110  Biosynthesis of secondary metabolites
dau01120  Microbial metabolism in diverse environments
dau01130  Biosynthesis of antibiotics
dau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_1572
   00620 Pyruvate metabolism
    Daud_1572
   00640 Propanoate metabolism
    Daud_1572
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Daud_1572
   00680 Methane metabolism
    Daud_1572
Enzymes [BR:dau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Daud_1572
Lipid biosynthesis proteins [BR:dau01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Daud_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACA60074
UniProt: B1I523
Position
complement(1659125..1661107)
Genome map
AA seq 660 aa AA seqDB search
MAVKKETIETLLEESRIFHPDEQFTRQANVKNRDIYAEARANPRIFWAMQAERLDWYRKW
DQVLDWEPPFAKWFVNGKLNACYNCVDRHLNTWRKNKAAIIFEGEPGDSRILTYWDLWRE
VTQFANVLRMLGVRKGDRVAIYLPMIAEAAIAMLACARIGAPHSVVFGGFSAEALRDRIN
DAGAKLLITADGGWRRGKIVPLKRNADAALTECPSVDKVLVVKRTGQEVPMQDGRDYWYD
NLVVGVTVGGPCEEMDSEDMLFILYTSGTTGKPKGVVHTTGGYLTGVSTTHHMVFDIKDR
DVYWCTADVGWVTGHSYVVYGPLANGATTVIYEGAPDFPEFDRFWAIIERYGVNVFYTAP
TAIRAFMKWGEEWPARRDLSSLRLLGTVGEPINPEAWIWYHKHIGSERCPIVDTWWQTET
GMIMISALPGIISTKPGSASVPLPGVEIDVVDKEGNSVMLGKGGFLVIKEPWPAMLRTIY
GDNERYVREYWGKIPGHTLYFSGDGARRDYHNYFWILGRVDDVINVAGHRLSTMEIESAL
VDHPWVAESAAIGKAHDLKGQAISVFVTLKGKYFKELKDGSKTRAEFTSELKAHVVKKIG
AIARPDDIFLTAELPKTRSGKIMRRLLRDIAEGRALGDTTTLADPAVCRELKEKYESKES
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcaagaaggagactatcgaaaccctactcgaggagagccgcatatttcacccc
gacgagcagttcacccggcaggccaacgtcaagaaccgggacatttacgccgaggcccgg
gcgaacccgcggattttctgggcgatgcaggccgagcgtctggactggtaccgcaaatgg
gaccaggtcctggattgggagcccccgttcgccaaatggttcgtgaacgggaagctgaac
gcgtgttacaactgcgtcgaccggcacctcaacacctggcggaagaacaaggccgccatc
atctttgagggtgaaccgggggatagtcgaattctgacctattgggacctatggcgcgag
gtcacccagttcgccaatgtgctacgcatgttgggggtccggaagggcgaccgcgtggcc
atctacctgcccatgatcgccgaggcggctatcgccatgctggcctgcgcccggatcggc
gcgccccacagcgtggtgttcggagggttttccgccgaagcgctgcgcgaccgtatcaac
gacgccggggcgaagctcttgattactgcggacggcggctggcgccggggcaaaatcgtg
cctctgaagcggaacgccgatgcggccctgacggagtgcccgtccgtggacaaggtcctg
gtggtcaagcgcaccggccaggaagtgccgatgcaggatgggcgcgactactggtacgac
aacctggtggtcggggtgaccgtaggcgggccgtgtgaggaaatggactccgaggatatg
ctcttcattctgtatacgagcggtaccaccggcaagcccaagggtgtggtccatactacc
ggcggctacctgaccggggtttccaccacccaccatatggtcttcgacatcaaggatcgt
gatgtttactggtgcacggcggacgtcggctgggttaccgggcacagctacgtggtttac
ggaccgctggcgaacggggcgacgacggtgatttacgagggggcgcccgacttccccgag
ttcgaccgcttctgggcgatcattgagcgctacggggtgaacgtattctacaccgcgccc
acggccattcgggcctttatgaagtggggcgaggagtggcctgcccggcgcgatctttcc
agcctgcgccttttaggcacggtcggtgagccgatcaacccggaggcctggatctggtac
cacaagcacatcgggtcggaacggtgcccgattgtggatacctggtggcagaccgaaacc
gggatgatcatgatcagcgccctgccggggatcatctccacgaagccgggctcagcttcg
gtgccgctcccgggcgtagagatcgacgtggtcgacaaggaagggaactcggtgatgctg
ggcaaaggcggctttctggtgatcaaggagccctggccggccatgctccgcaccatttac
ggcgataacgagcggtacgtgcgcgagtactggggcaagattccgggccacaccctgtac
ttctccggggacggtgcgcgccgcgactatcacaactacttctggatcctgggccgggtc
gacgacgtgatcaacgtggccggacaccggctgagcaccatggaaatcgagagcgcgctg
gtcgatcacccctgggtggccgaatcggcagcgatcggcaaggcgcacgatctcaagggg
caggccatctcggtgttcgtgactttgaaagggaagtacttcaaggagctcaaggacggg
tcgaagacaagggccgaattcacgtccgaactcaaagcccacgtggtgaagaaaatcggg
gcgatcgcccggccagacgacatcttcctgaccgccgaactgccgaagaccagaagcggc
aagatcatgcggcgcctgctgcgggatatcgccgagggccgggccctgggcgacaccacc
accctggccgaccccgcggtctgccgggaactcaaggaaaagtacgagagcaaggaatct
taa

DBGET integrated database retrieval system