KEGG   Candidatus Desulforudis audaxviator: Daud_1616
Entry
Daud_1616         CDS       T00655                                 

Definition
(GenBank) peptidase S55, SpoIVB
  KO
K06399  stage IV sporulation protein B [EC:3.4.21.116]
Organism
dau  Candidatus Desulforudis audaxviator
Brite
KEGG Orthology (KO) [BR:dau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dau01002]
    Daud_1616
Enzymes [BR:dau01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.116  SpoIVB peptidase
     Daud_1616
Peptidases and inhibitors [BR:dau01002]
 Serine peptidases
  Family S55: SpoIVB peptidase family
   Daud_1616
SSDB
Motif
Pfam: Peptidase_S55 PDZ_6 PDZ_2 PDZ Tricorn_PDZ
Other DBs
NCBI-ProteinID: ACA60118
UniProt: B1I568
Position
complement(1702408..1703730)
AA seq 440 aa
MPGSIRKRISQAGFIFFAILLIFGCFTPFSRSFFGLPVYQNILVGESVAPSLQVPGSLKS
VLQWESDRPEAIRLLETGGSPVIREAGEYRLSLKLFGFIPLRHLTVSAVPEVKVLPGGQS
IGVLLHSRGVIVIGEAPLESGEREYSPAYQAGIREGDVILSINGREVRCEADVREMVNEV
GGNGERLAVRLKRNGVEFLVGVTPDYCERTGRYRVGLLVRDSAAGVGTLTFHDPKTGSYG
ALGHVITDGRSPQRLELTDGRIVEAEIRGVHPGMRGRPGEKLGAFAGEGSFTGSIDRNTT
YGIFGTLEGNISNPYFREPIPVALLHHVRPGPAVMLTVLHDRQIERFNLMIEEVRPENGG
DGKGLVIRIDDERLLERSGGIIQGMSGSPIIQNGRLVGAVTHVFINNPSRGYGVPIEWML
RESGLLKKPTEVSIQWRKVG
NT seq 1323 nt   +upstreamnt  +downstreamnt
gtgcctgggtccatcagaaagagaatttcccaagccggctttattttttttgctattttg
ctcattttcggttgttttactcctttttcacgtagttttttcggtttacccgtctatcag
aacatactggtaggggagtcggttgctccttcccttcaagtgcccggatctctaaaatcg
gttctgcagtgggagtccgaccgcccggaagcgatccggctgctggaaaccggcgggtca
ccggtgatcagggaggccggtgagtaccgcttgagtctgaaactgttcggatttatccct
ctgcgacacctgaccgtaagcgctgtgcccgaagtgaaggtgctgccgggcggtcagtcg
atcggtgtgctccttcattcccggggtgtgatcgtgatcggtgaagcacccctcgagagc
ggggagagggaatacagcccggcgtaccaggcgggcatccgggagggggacgtgatcctt
tccatcaacggccgggaggtgcggtgtgaggccgacgtccgggaaatggtgaacgaagta
ggcggaaacggcgagagactggccgtgcgcctgaagcgtaacggcgtcgagttcctggtg
ggagtaacacccgactattgtgagcggaccggccggtaccgggtggggcttttggtccgc
gacagcgccgccggggtgggcacgctgacgtttcatgatccgaaaacgggttcctacggg
gctctcgggcacgtgatcaccgacggccgttcgccacagcgcctggaattgaccgacggc
cggatcgtggaagccgaaatccgcggggtgcacccggggatgcgcggccgcccgggagag
aaactgggtgcttttgcgggggaaggttctttcaccggttccattgatcggaacaccacg
tatgggattttcggcaccctggaagggaacatctccaacccgtatttccgggaaccgatc
ccagtggccctgttgcaccacgtacggcccggcccggccgtaatgctgaccgtgcttcac
gaccggcagatcgaacggttcaacctgatgatcgaagaggtccgacccgaaaacggcggt
gacgggaagggcctggtgatcaggatcgacgacgagcggctgctggagcgttccggcgga
atcattcaggggatgagtggcagtccgattattcaaaacggccggttggtcggcgcggtg
acccacgtgtttatcaacaatccctcccggggttacggagtacctatcgaatggatgctc
cgggagtccggcctgttgaagaaaccgacggaggtgtccatccaatggcgtaaggtcgga
taa

DBGET integrated database retrieval system