KEGG   Candidatus Desulforudis audaxviator: Daud_2043Help
Entry
Daud_2043         CDS       T00655                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00010  Glycolysis / Gluconeogenesis
dau00350  Tyrosine metabolism
dau00620  Pyruvate metabolism
dau00625  Chloroalkane and chloroalkene degradation
dau00626  Naphthalene degradation
dau00650  Butanoate metabolism
dau01100  Metabolic pathways
dau01110  Biosynthesis of secondary metabolites
dau01120  Microbial metabolism in diverse environments
dau01130  Biosynthesis of antibiotics
dau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daud_2043
   00620 Pyruvate metabolism
    Daud_2043
   00650 Butanoate metabolism
    Daud_2043
  Lipid metabolism
   00071 Fatty acid degradation
    Daud_2043
  Amino acid metabolism
   00350 Tyrosine metabolism
    Daud_2043
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Daud_2043
   00626 Naphthalene degradation
    Daud_2043
Enzymes [BR:dau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Daud_2043
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Daud_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_IclR RNA_pol_A_CTD
Motif
Other DBs
NCBI-ProteinID: ACA60533
UniProt: B1I685
Position
2152312..2154888
Genome map
AA seq 858 aa AA seqDB search
MTEDQAAVKKDIDDLVSRARNALEQFRGLGQERVDEIVRSAALAGLERHMELARMAVEET
GRGVYEDKILKNLYAVEYVYNSIRDRKTAGVVYEDPETGYREIAEPAGVIAALIPLTNPT
STTLFKGLIALKTRNPVVFSFHPGARRSSTAAAEALLEGAVAAGAPPECLLWIEDPTVEA
ARTLMRHPGVNLILATGGTAMVRAAYSAGIPALGVGPGNVPCYIHRTAHLERAVTDLILS
KTFDHGMICASEQALIVDRAVSNRVRELMEAAGCRFLNAGETRLLEQLATAGRTCSLNPQ
IVGKSPVDIARMAGFEVPEDTKILVAVQEGVGPDHPLSREKLSPVLAFYVVGDTGAAIER
AAEVVRYEGLGHTAVIHAADREVIESFSQRVPAGRIILNSPASQGALGDLYNVLTPSLTL
GCGYIGHNSTTDNVSAVHLVDIKRVAPRRAETQWFRVPPEIYFEPGSLSLLSQMPGLGRV
FLVTDEVLAELGYVDRVRRHLESRTEPVRLKVFSGVEPNPSLETVRRGTRRLGEFNPDTI
IALGGGSVIDAAKAMWLFHEYPEVRFEHLKLKFTDIRKRTYRLPARPRKTRLVAVPTTSG
SGSEVTAFAVITDRDRDIKYPLADYALTPDVAIVDVDLAMGQPPALTADAGMDVLGHALE
AYVSVRASDFTDPPAIKAIEAVFRYLPRAYRNPGDREAREKMHTAATLAGMAFTNAFLGV
NHSLAHKLGNEFNLPHGRAVAVLMPHVIEYNAEVPAKYASYPNYGYYRAAERYQEIARHL
GLPASTAAEGSAGLAETVRRLIAELDLPPTIAACGVPRDRFEARLALLAEKAYEDQTTVT
NPRQPLISELIALYRRAY
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagatcaggcggcagtgaagaaagacatcgacgatctggtgtctcgggctcgg
aacgcgctggagcagttccgcgggctgggccaggagcgggtggacgagatcgtccggtcc
gccgccctggccgggctggagcggcacatggaactcgcccggatggccgttgaggaaacc
ggccgtggggtgtacgaggataagattctcaagaatctctacgccgtggagtacgtctac
aacagtatccgggaccggaaaacggccggggtggtctacgaggacccggaaaccggttac
cgggaaatcgccgagccggccggggtgatcgcggccctgattccgctgaccaaccctacc
tcgaccaccctgttcaagggcctgatcgccctgaaaaccagaaacccggtggtgttcagt
ttccaccccggagccaggcgctccagtaccgccgccgccgaggccctgctggaaggtgcc
gtggccgccggcgccccgccggaatgcctgctctggatcgaggacccgacggtagaggcg
gcccggacgctgatgcgccaccccggggtgaacctgattctggccaccggggggaccgcc
atggtgcgcgccgcgtacagcgccggcatcccggcactgggcgtcggccccggaaacgtg
ccctgctacattcaccggaccgcccacctggagcgggcggtgaccgacctgatcctgagc
aagaccttcgatcacgggatgatctgtgcctcggaacaggcgctgattgtggaccgggct
gtttccaaccgggtaagggagttgatggaggccgcgggctgccggttcctgaacgccggg
gaaacccggctcctggagcagctggccaccgccggccggacatgctccctgaacccgcaa
atcgtgggcaaaagcccggtggacattgcccgcatggccggtttcgaggtacccgaggac
acgaaaatcctggtggccgtgcaggaaggcgtcggccccgaccacccgctctcccgggaa
aaactcagcccggtgctggccttctacgtggttggcgataccggcgccgccatcgagcgg
gccgcggaagtggtgaggtacgaaggtctgggccatacagcggtgatccacgccgccgac
cgggaggtgattgaaagtttttcgcagcgggtgccggccgggcggatcattttgaactcc
ccggccagccagggtgccctgggcgacctgtacaacgtgctcaccccgtcgcttaccctg
ggctgcggctacatcggtcacaactccaccaccgacaacgtcagcgccgtccacctggtg
gacatcaagcgggtcgcgccgcgccgcgccgaaacccagtggttccgggtgccgccggaa
atctactttgagcccggctccttgagcctcttaagccagatgccaggcttagggcgggtg
ttcctggtcacggacgaagtgctcgccgaactgggttacgtggaccgcgtgcgccggcac
ctggagagccggaccgaaccggtccggctcaaggtgttctccggcgtggaaccgaacccc
tccttagaaacggtgaggcggggcaccaggcgtctgggggaattcaaccccgacaccatc
atcgccctgggcggcggttcggtcatcgacgccgccaaggcaatgtggcttttccacgag
tatcccgaggtccgctttgagcacctgaagttaaaattcacggatatccggaagcgcact
taccgcctgcccgcgcggccgcggaaaacccggctggtggccgtgccgaccacctccggg
agcggctccgaggtcaccgcctttgcggtgatcaccgaccgggaccgggacatcaagtac
ccgttggccgactacgccctgacccccgacgtggccatcgtcgatgtcgatttggcgatg
ggtcagcccccggcgcttaccgccgacgccggcatggacgttctgggccacgccctagaa
gcctacgtttcggtgcgggcgtccgatttcaccgaccccccggccataaaggccattgaa
gcggtcttccggtacctgccccgggcctatcgcaaccccggcgaccgcgaggcccgggag
aaaatgcacaccgccgccaccctggccggaatggctttcaccaacgcctttctgggcgtc
aatcacagcctggcgcacaagctcggaaacgaattcaaccttccgcacgggcgcgccgtc
gccgtgctcatgccccacgtgattgagtataacgcggaggtaccggccaagtacgcctcc
tatccgaactacgggtactaccgggccgcggagcgttaccaggaaatcgcccggcacctg
gggctcccagcgtcaaccgccgcagaggggtcggccggcctggcggaaaccgtgcggcgc
ctgatcgcggaacttgacctgcccccgaccatcgccgcctgcggcgtgccgcgggaccgg
ttcgaggcccggctggccctgctggccgaaaaggcttatgaagatcagacgacggtgacc
aacccccgccagcccctgatctccgaactgattgcactttaccgccgggcctattga

DBGET integrated database retrieval system