KEGG   Desulfurella acetivorans: DESACE_00715Help
Entry
DESACE_00715      CDS       T03007                                 

Definition
(GenBank) glycyl-tRNA synthetase
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
dav  Desulfurella acetivorans
Pathway
dav00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dav00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DESACE_00715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dav01007]
    DESACE_00715
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dav03016]
    DESACE_00715
Enzymes [BR:dav01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     DESACE_00715
Amino acid related enzymes [BR:dav01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   DESACE_00715
Transfer RNA biogenesis [BR:dav03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DESACE_00715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AHF96535
UniProt: W0JD30
Position
144201..145043
Genome map
AA seq 280 aa AA seqDB search
MNYQDIPLKLSEFWKSKGCVILQPYDIESGAGTFHPATVLKSLGDKPWSVAYTAPSRRPT
DGRYGENPNRLQHYYQYQVIIKPSPENIQEMYLESLEFLGISVKQHDIRFVEDNWESPTL
GAWGLGWEVWLDGMEVTQFTYFQQIGGVDLKLIPVEITYGTERLGMYIQGVENVFDMKFN
DHLTYGDIHKHDEWEYSTYNFEVADVKMLFELFNMFENESNRCIQANLIRPAYDYCIKCS
HVFNLLDARSAISVSERTHYIKRVRDLAVAIAKAYVGESQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaggacataccactaaaattatcggagttttggaaatcgaaaggctgtgta
atattgcaaccctacgatattgagtctggtgcaggaacatttcatcctgctacagtatta
aaatcgcttggcgataagccctggagtgttgcctatactgctccttcaagaagaccaacc
gatggtaggtatggtgaaaatcccaatagactccagcattactaccaatatcaagtaatt
attaagccctcaccggaaaacattcaggaaatgtatttagaaagtcttgaattcttaggc
atatcggtaaagcaacacgatataaggtttgttgaagataactgggaatctcctacgctt
ggcgcatggggtcttggctgggaagtatggttagatggtatggaagtaacacagtttaca
tattttcagcaaataggtggtgttgatttaaaactcatacctgtcgaaataacgtatggc
acagaaagacttggtatgtatattcaaggtgtagaaaatgtttttgatatgaaatttaac
gatcatttaacttatggcgatattcataagcacgatgaatgggaatattctacatacaat
tttgaagttgctgatgtaaaaatgctttttgagttatttaacatgtttgaaaatgaatca
aacaggtgcatacaggctaatcttataaggccagcgtatgattattgtattaaatgttct
catgtttttaacctgcttgatgcaaggagtgcaattagcgtatcagagcgtacgcattat
ataaaaagggtgcgcgatctggctgttgccatagcaaaagcttatgtaggagaaagccaa
tga

DBGET integrated database retrieval system