KEGG   Desulfurella acetivorans: DESACE_01865Help
Entry
DESACE_01865      CDS       T03007                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dav  Desulfurella acetivorans
Pathway
dav03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dav00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DESACE_01865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dav03011]
    DESACE_01865
Ribosome [BR:dav03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DESACE_01865
  Bacteria
    DESACE_01865
  Archaea
    DESACE_01865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHF96692
UniProt: W0JI35
Position
358423..358773
Genome map
AA seq 116 aa AA seqDB search
MEHTVKLSRARISPIKVRQVFGLIKGKKANEAISILKLMPKKSALILSKLIESAVAGCLE
KGEDPNKFYIKTVCADDGIRFKRYRPMAMGRAGRILKRTTNIKLVLAKEVDFGSKG
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtggaacacacagttaaattgtcaagagcaaggatttcgcctataaaagttagacaggtt
tttggtctgataaaaggcaaaaaagcaaatgaagcaatatctatattaaaacttatgcct
aaaaaaagcgctttgatactttcaaaattaatagaatccgctgttgcaggatgtttagaa
aaaggtgaagatcctaataaattttatattaaaacagtatgcgctgatgatggtataaga
tttaaaaggtatagaccaatggctatgggtcgtgcaggtagaatacttaaaagaaccaca
aacataaaactcgtattggcaaaggaggtggattttgggtcaaaaggttaa

DBGET integrated database retrieval system