KEGG   Desulfurella acetivorans: DESACE_02745Help
Entry
DESACE_02745      CDS       T03007                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dav  Desulfurella acetivorans
Pathway
dav00071  Fatty acid degradation
dav00072  Synthesis and degradation of ketone bodies
dav00280  Valine, leucine and isoleucine degradation
dav00310  Lysine degradation
dav00362  Benzoate degradation
dav00380  Tryptophan metabolism
dav00620  Pyruvate metabolism
dav00630  Glyoxylate and dicarboxylate metabolism
dav00640  Propanoate metabolism
dav00650  Butanoate metabolism
dav00900  Terpenoid backbone biosynthesis
dav01100  Metabolic pathways
dav01110  Biosynthesis of secondary metabolites
dav01120  Microbial metabolism in diverse environments
dav01130  Biosynthesis of antibiotics
dav01200  Carbon metabolism
dav01212  Fatty acid metabolism
dav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DESACE_02745
   00630 Glyoxylate and dicarboxylate metabolism
    DESACE_02745
   00640 Propanoate metabolism
    DESACE_02745
   00650 Butanoate metabolism
    DESACE_02745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DESACE_02745
   00072 Synthesis and degradation of ketone bodies
    DESACE_02745
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DESACE_02745
   00310 Lysine degradation
    DESACE_02745
   00380 Tryptophan metabolism
    DESACE_02745
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DESACE_02745
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DESACE_02745
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DESACE_02745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dav04147]
    DESACE_02745
Enzymes [BR:dav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DESACE_02745
Exosome [BR:dav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DESACE_02745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHF96822
UniProt: W0JIL4
Position
516650..517822
Genome map
AA seq 390 aa AA seqDB search
MREVYVIEALRTPFGSFGGNLSGVEAPLLASEVIKELLKRTNISGDDVDEIIMGEVLSGG
VGQAPARQAMIYAGLPYKVHAMTINKVCGSGLKAIMLGAGSIMLGDSDIVIAGGAENMSK
APYYLKNARYGYRMGNGDLIDGMIFDGLWDPYDNIHMGTIAENIAKKHSISRKEQDDYAV
RSYELAQKAQDSVFKDEIVPFVIKDKKGDKVIDKDEDPYKVVFDKIPTLKGAFVKDGTVT
AANSSTISDGAALCILASQDALKNYNLKPLAKLVAYSTNSLPPQQFPEAPVGAIEKVVKR
AGLSLKDIDLFEINEAFAVVVLVAIKQLGLDINKVNVNGGAVSIGHPIGASGGRLVATLV
KQMKRQNAKYGLATLCIGGGEAVAAIFENV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggtttatgtaatcgaagccctaagaacgccatttggatcatttggtggaaat
ttatcaggtgttgaagcgccactgcttgcaagcgaggtaattaaagagttactcaaacgc
acaaatatttctggcgatgatgttgatgaaattatcatgggcgaggttttaagcggtggg
gttggccaggctccggcaaggcaggctatgatttatgcaggtcttccatataaagtacat
gcaatgacaatcaataaagtatgtggttctggtttaaaagctattatgcttggtgctgga
tctattatgcttggtgatagtgatattgtgattgctggcggtgcagaaaatatgtcaaaa
gctccatactacctaaaaaacgcaaggtatggttaccgcatgggaaatggagatctaata
gatggtatgatttttgatggcttgtgggatccctacgataatattcatatgggtaccatt
gcagaaaatatagcaaaaaaacactcaataagcagaaaagagcaagatgattatgctgtc
aggtcttatgagcttgcccaaaaggcacaagatagcgtatttaaagacgagatagttccg
tttgtgataaaggataaaaaaggcgataaagttattgataaagatgaagatccatacaaa
gtagtattcgataaaattcctacacttaagggtgcatttgtaaaagacggtacagttact
gcggctaactcatctacaatatcagatggtgcagctttatgtatccttgccagccaagat
gcactaaaaaattataatctaaaaccacttgctaaacttgtcgcatactctacaaactca
ctacccccacagcagttccctgaagctccagttggcgcaatagaaaaggtagtaaaaaga
gcagggttatcgcttaaagacatagacttatttgagataaatgaggcatttgctgttgta
gtgttagttgctataaaacagcttggtcttgatataaataaagtaaacgtaaatggcggt
gctgtttctataggtcacccaattggtgcaagtggtggcagactcgttgctacgcttgta
aagcaaatgaaaagacaaaacgccaaatacggacttgccactctttgcataggtggtggt
gaagcagtagcagcgatatttgaaaatgtttaa

DBGET integrated database retrieval system