KEGG   Desulfurella acetivorans: DESACE_07050Help
Entry
DESACE_07050      CDS       T03007                                 

Definition
(GenBank) hypothetical protein
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
dav  Desulfurella acetivorans
Pathway
dav00520  Amino sugar and nucleotide sugar metabolism
dav01100  Metabolic pathways
dav01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:dav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DESACE_07050
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    DESACE_07050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dav01005]
    DESACE_07050
Enzymes [BR:dav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     DESACE_07050
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     DESACE_07050
Lipopolysaccharide biosynthesis proteins [BR:dav01005]
 Unusual sugar
  DESACE_07050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N Formyl_trans_C Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: AHF98087
UniProt: W0JM60
Position
1334367..1335266
Genome map
AA seq 299 aa AA seqDB search
MKTVVFAYHNMGVIGCSALKKHGFDIKCVFTHKNDENENIWFESVQAWCEKNNIEYFTPE
NVNTKEWIDKIASYKPDIIFSFYYRNLICEDILKLAPFKAINLHGSCLPAYRGRAPVNWV
LVNGEKQTGVTLHYMVKKPDAGDIIAQKCIDIDFYDTAKTLYEKLEKLAFTLLDETLPHI
KNNTVKPVKQDESKASYFGRRTKQDGLIDFNKTSIEIYNLIRAVTKPYPGAFCYYKGKEL
IIWWAIPYSIQLKPKQIAKIDNKVYIGSKVGSLELKEVEYDGKTYKEKEILNLLEGGYL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggttgtttttgcatatcataatatgggcgtaattggttgttcagccctcaaa
aaacatggatttgacattaaatgtgtttttactcataaaaatgatgaaaacgaaaatata
tggtttgaaagtgttcaagcctggtgcgaaaaaaataatatagaatattttacgccagaa
aatgtaaatacaaaagaatggattgataaaattgcaagctataaacctgatattattttt
tctttttactacaggaatctcatatgtgaagatattctaaaacttgcgccttttaaagct
ataaatttacatggatcatgccttccagcttatcgtggcagagctcctgttaattgggtt
ttggtaaatggtgaaaaacaaacaggcgttacacttcattatatggtaaaaaaacctgat
gcaggcgatattattgctcaaaagtgcatagatatagacttttatgatacagcaaaaaca
ctttatgaaaaactggaaaaattagcctttacacttttggatgaaactttgccacatatt
aaaaacaatacagtaaagccagtaaaacaagatgagtcaaaagcaagttattttggtaga
agaactaagcaagatggtctaattgattttaataaaacttctatagaaatatacaattta
ataagagctgtaacaaaaccctaccctggtgcattttgctactataaaggtaaagaacta
attatatggtgggcaataccttatagcatccaattaaaaccaaaacaaattgccaaaata
gacaataaagtctacattggatctaaagtgggttcgttggaattaaaagaagttgaatac
gatggtaaaacatataaagaaaaagaaattttaaatcttttagaagggggatatttgtga

DBGET integrated database retrieval system