KEGG   Desulfurella acetivorans: DESACE_08340Help
Entry
DESACE_08340      CDS       T03007                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
dav  Desulfurella acetivorans
Pathway
dav00540  Lipopolysaccharide biosynthesis
dav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dav00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DESACE_08340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dav01005]
    DESACE_08340
Enzymes [BR:dav01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     DESACE_08340
Lipopolysaccharide biosynthesis proteins [BR:dav01005]
 Unusual sugar
  DESACE_08340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_4 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AHF97476
UniProt: W0JJN1
Position
complement(1573337..1574251)
Genome map
AA seq 304 aa AA seqDB search
MDILITGGAGFIGSNLALALQKMADNISVVDDFSKGVYKNLEGFEGDVVVADISIKNFDW
EHYLDFEPDYIFHEASNTDTTYPDDKEMLRSNIEGFRNVLELAINSQAKVIYASSAGVYG
KGTIPMSENSQRDPKNAYAFSKYIMENIARKYAENYDLECVGLRYFNVYGPRESFKGKAA
SMIYQLALQIKEGKRPRIFEFGEQFRDQIYVKDVVEANLQAMESPSGVYNVGTGKPTTFN
KIVEVLNKVLKTNLEPEYIKNPYTQFYQDQTLADMNLSASKMGFVAKYDIESGIEDYMRW
LGFA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggatatattaattacaggtggtgctggctttattggatcaaatttagctcttgcactt
caaaaaatggctgataatatatcagttgttgatgatttttccaaaggtgtctacaaaaat
cttgaaggttttgaaggagatgttgtagtcgcagatatatctattaaaaattttgattgg
gagcattatttagattttgaaccagactatatttttcatgaggcttcaaatactgataca
acatatccagacgataaagagatgctaagaagcaatattgaaggttttagaaatgtacta
gagttagctataaattctcaagccaaagttatttatgcatcaagtgctggtgtttatgga
aagggtactatccctatgagtgaaaattctcaaagagacccaaaaaatgcatatgcgttt
tcaaagtatataatggaaaatatagcaagaaaatacgcagaaaattatgatttagaatgt
gtgggtttgagatactttaatgtttatggtcccagggaatcttttaaaggcaaagcagca
agtatgatttatcaattagctttgcaaataaaagaaggcaaaagaccgcgcatatttgaa
tttggagagcaatttagagaccagatttatgttaaagatgtggttgaggcaaacttgcaa
gctatggaatcaccatccggtgtttataatgtgggcactggtaaacctacaactttcaat
aaaattgtggaagttttaaataaagttttaaaaacaaacttagaaccagaatatataaaa
aatccctacactcaattttatcaggaccaaacattggctgatatgaatttatctgcaagt
aaaatgggttttgtagcaaagtacgatatagaatctggtatagaagattacatgaggtgg
cttggctttgcttga

DBGET integrated database retrieval system