KEGG   Desulfoglaeba alkanexedens: FDQ92_06230Help
Entry
FDQ92_06230       CDS       T05964                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
dax  Desulfoglaeba alkanexedens
Pathway
dax01100  Metabolic pathways
dax01120  Microbial metabolism in diverse environments
dax01200  Carbon metabolism
Brite
Enzymes [BR:dax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     FDQ92_06230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD
Motif
Other DBs
NCBI-ProteinID: QCQ21814
UniProt: A0A4P8L278
Position
complement(1342089..1342970)
Genome map
AA seq 293 aa AA seqDB search
MKLIGENLNIMSKKYGKALKERDAKTLQELAVIEAEAGMDYIDLNIGPAGKTGEEMMSWL
VPVIHEVVDLPLALDTSNVKAIEAGLKAHKKGRAMINSIMVRQERMDALLPLAKEYDAEF
IGLLWGPEGMPRDENERGALCAELLFRASDLGIVPERIYIDPIQTPVNVQQIQIMSALAF
MDMFADMAPGCRSTIGLSNVSNGAPEHLRPILNQVMLILWKRRGMTSAIVDTFDKKLHQI
AKGKRPELEALVAKVEDGEEIDMASLSKEEQDFVKTAKVILGHTLYSDSWLEV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttattggtgaaaatctcaatatcatgagcaaaaaatacgggaaggctctgaag
gagcgggatgccaagacgctgcaggagttggcggtgatcgaggccgaagccggtatggac
tacattgatctcaacataggtccggccggcaagacgggcgaggaaatgatgagctggctg
gtgccggtgatccacgaagtggtggatctgccgctggcgctcgatacgtccaatgtgaaa
gccatcgaagcggggctcaaggcccacaagaagggccgggccatgatcaattccatcatg
gtgcgccaggaacgcatggatgcgctgctgccgcttgccaaggaatacgatgcggagttc
atcggactgctgtggggaccggaaggcatgccgcgggatgaaaatgaacgcggcgcgctg
tgcgccgagctgcttttccgggcgagcgatctgggaattgtcccggaaaggatttacatc
gacccgattcagacgcccgtgaacgttcagcagattcagatcatgagtgcgcttgctttc
atggatatgttcgccgacatggcgccggggtgtcgcagcactatcgggctgtccaacgtt
tccaacggagcgccggagcatttgcggccgatcttgaaccaggtcatgctcatcctttgg
aagcggcgcggcatgacctcggccatcgtggataccttcgacaagaaactgcaccagatc
gccaaggggaagcgcccggaactggaagcgctggtcgccaaggtggaagacggcgaagaa
atcgacatggcatcgctcagcaaagaagagcaggacttcgtcaagacagccaaggtgatc
ctcgggcataccctttattcggattcctggctggaggtttga

DBGET integrated database retrieval system