KEGG   Desulfoglaeba alkanexedens: FDQ92_07065Help
Entry
FDQ92_07065       CDS       T05964                                 

Definition
(GenBank) polyprenyl synthetase family protein
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
dax  Desulfoglaeba alkanexedens
Pathway
dax00900  Terpenoid backbone biosynthesis
dax01100  Metabolic pathways
dax01110  Biosynthesis of secondary metabolites
dax01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dax00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FDQ92_07065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dax01006]
    FDQ92_07065
Enzymes [BR:dax01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     FDQ92_07065
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     FDQ92_07065
    2.5.1.29  geranylgeranyl diphosphate synthase
     FDQ92_07065
Prenyltransferases [BR:dax01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   FDQ92_07065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt SQS_PSY
Motif
Other DBs
NCBI-ProteinID: QCQ21956
UniProt: A0A4P8L244
Position
complement(1547284..1548189)
Genome map
AA seq 301 aa AA seqDB search
MESFDLEGYLAERRERVDRALDVFFPASSGLEKTVVEAARYSLFAGGKRLRPILCLAAAE
VMGGTADDAMPAACALEMIHTYSLIHDDLPAMDNDDFRRGKPTNHKVYGEAVAILAGDTL
LTEGFGLVADPNLGNNGNLPPEKRLQVIHILVKAAGYRGMIGGQVIDLEGETREMDFPTV
KYMHIRKTGALISASLEIGGLLGGCEATDLQRLVRYGKHLGLAFQITDDLLDVEGDAVLM
GKTPGSDVARNKKTYPALLGITLSREAAKEHVNQAVEALRTFDRRAEPLRAIARYLLERK
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaatccttcgatcttgaaggctacctggcggaacgcagggaaagagtggaccgggcg
ctggatgtcttttttccggcgtcgtcggggctggaaaagaccgtggtcgaagcggcccgg
tacagcctttttgcaggcggaaagcggctccggcccatcctgtgcctcgcggcggcggag
gtgatgggcggcacggcggacgatgcgatgcccgcggcctgtgccctggaaatgatccac
acctattcgctcatccacgacgatctgccggccatggacaacgacgatttccgccgggga
aaacccacgaaccataaggtctacggggaagcggtcgcgatcctggcgggcgacacgctg
ctgacggaaggcttcggcctggtagccgacccgaacctgggcaacaatgggaacctgccc
cctgaaaagcgcctgcaggtgatccacattctggtgaaagccgccggataccggggcatg
atcggcggtcaggtgatcgacctggaaggcgaaacccgcgagatggatttccccacggtg
aagtacatgcacatccggaagaccggggcgctcatttcggcttccctcgaaatcggcgga
ctcctggggggatgtgaagcaaccgatctgcagcggctcgtccgctacggcaagcacctg
ggactcgcttttcagatcacggacgatcttctggacgtggaaggcgacgcggttctcatg
gggaaaaccccgggttccgacgtcgccaggaacaaaaagacctatccggcgctgctgggt
atcacgctaagccgggaagcggcgaaagagcatgtgaaccaggcggtggaagcgctccgc
accttcgaccggcgcgcggaaccgcttcgagccatcgcacgttatctcctggagcggaag
tcttga

DBGET integrated database retrieval system