KEGG   Drosophila arizonae: 108608922Help
Entry
108608922         CDS       T05886                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
daz  Drosophila arizonae
Brite
KEGG Orthology (KO) [BR:daz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:daz03110]
    108608922
Enzymes [BR:daz01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     108608922
Chaperones and folding catalysts [BR:daz03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    108608922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 108608922
NCBI-ProteinID: XP_017856050
Position
2
AA seq 130 aa AA seqDB search
MPPKKDTKGGKDNAKGGKKPAAEDKGAGKEKKGGNAVKVRHILCEKQGKIMEAMEKLKAG
QKFPEVAAAYSEDKARQGGDLGWQIRGAMVGPFQDAAFALPISTVNSPVYTDPPIKTKFG
YHIIMVEGKK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaaaaaggatacgaaaggtggaaaggataacgcaaaaggtggcaagaaacca
gctgcggaggataaaggtgccggcaaagaaaagaaaggcggcaatgcggtgaaggtgcga
cacattctctgtgagaagcagggcaagattatggaggcaatggaaaagttaaaagctggt
cagaaatttcctgaagtggcagcagcytacagtgaagacaaagcacgccagggtggcgac
ttaggctggcaaatacgcggagcaatggttggccccttccaggacgcagctttcgctctg
ccgatatccacggtcaacagtcccgtttacacagatccaccgataaagacgaaatttggc
tatcacataatcatggtcgagggaaagaaatag

DBGET integrated database retrieval system