KEGG   Drosophila arizonae: 108611143Help
Entry
108611143         CDS       T05886                                 

Definition
(RefSeq) alcohol dehydrogenase 2
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
daz  Drosophila arizonae
Pathway
daz00010  Glycolysis / Gluconeogenesis
daz00071  Fatty acid degradation
daz00350  Tyrosine metabolism
daz00830  Retinol metabolism
daz00980  Metabolism of xenobiotics by cytochrome P450
daz00982  Drug metabolism - cytochrome P450
daz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108611143
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108611143
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108611143
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    108611143
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108611143
   00982 Drug metabolism - cytochrome P450
    108611143
Enzymes [BR:daz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     108611143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR ThiF Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 108611143
NCBI-ProteinID: XP_017859112
UniProt: P27581
Position
3
AA seq 254 aa AA seqDB search
MAIANKNIIFVAGLGGIGFDTSREIVKSGPKNLVILDRIENPAAIAELKALNPKVTVTFY
PYDVTVSVAETTKLLKTIFDKLKTVDLLINGAGILDDYQIERTIAVNFTGTVNTTTAIMS
FWDKRKGGPGGVIANICSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSIN
PGITKTTLVHKFNSWLDVEPRVAELLLEHPTQTTLQCAQNFVKAIEANQNGAIWKLDLGT
LEAIEWTKHWDSHI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgctaacaagaacatcatcttcgtcgctggactcggtggcattggattcgac
accagtcgcgagattgtcaagagcggaccgaagaacttggtaatccttgatcgcattgag
aacccagctgctattgccgagctgaaggcactcaaccccaaggtgaccgttacgttctat
ccctatgatgtcaccgtctcggtagcagagactacaaagctattgaagacaatcttcgac
aagctgaagacagtcgatctgctcatcaatggagctggcatcctggacgactaccagatc
gagcgtactattgcggtgaacttcacaggcacagtgaacaccaccacggccatcatgtcc
ttctgggacaagcgcaagggcggcccaggcggtgtcattgccaatatctgctcggtaact
ggcttcaatgccatctaccaggtgcctgtgtactccgcatccaaggcagctgctctcagc
ttcaccaactctctggccagactggcgcccattaccggcgtgactgcctactccattaac
cctggcatcacgaagacaactctggtccacaagttcaactcgtggctggatgtggagcct
cgtgtggccgagctgcttctggagcatcccactcagacaactctgcagtgcgcccagaac
tttgtcaaggctattgaagccaaccagaatggcgccatctggaaactggacttgggtacc
ctggaagccattgaatggaccaagcactgggattcgcatatctaa

DBGET integrated database retrieval system