KEGG   Drosophila arizonae: 108611630Help
Entry
108611630         CDS       T05886                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
daz  Drosophila arizonae
Pathway
daz00350  Tyrosine metabolism
daz00360  Phenylalanine metabolism
daz00380  Tryptophan metabolism
daz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108611630
   00360 Phenylalanine metabolism
    108611630
   00380 Tryptophan metabolism
    108611630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:daz04147]
    108611630
Enzymes [BR:daz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     108611630
    4.1.1.105  L-tryptophan decarboxylase
     108611630
Exosome [BR:daz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108611630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 108611630
NCBI-ProteinID: XP_017859858
Position
3
AA seq 481 aa AA seqDB search
MEAPEFKDFAKSMVDYIADYLENVRDRRVLPEVKPGYLQPLIPDAAPEKPENWQDVMKDI
ERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMLD
WLGKMLDLPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKIQQVKKEHPEWDEHTII
GKLVGYSSAQAHSSVERAGLLGGVKLRSVPADEHNRLRGDALEQAIKEDLAAGLIPFYAV
VTLGTTNSCAFDRLDECGAVANKYNVWVHVDAAYAGSAFICPEYRHHMKGIETADSFNFN
PHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKL
WFVLRLYGVENLQAHIRRHCGFAKQFGDLCQQDKRFELAAEVSMGLVCFRLKGSNERNEA
LLKRINGRGNIHMVPAKIRDVYFLRMAVCSRFTRSEDMEYSWKEVSAAADELEQSEADEK
Q
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgcccgaattcaaagactttgccaaatcaatggttgattatatagccgattac
ctggagaatgtgcgcgacaggcgggtgctgcccgaggtgaagccaggctatttgcagcca
ttgataccggatgcggcgccagagaagccggagaattggcaggatgtgatgaaggacatt
gagcgagtcatcatgcccggtgtgacccactggcacagccccaagttccatgcctatttc
ccgacagccaactcgtatccagccatcgtagcggacatgctgagtggagcaattgcttgc
attggattcacttggatagcgagtccggcctgcacggagctggaggtggttatgcttgac
tggctgggcaagatgctggatctgccagctgaatttttggcttgctccggaggaaaaggt
ggcggcgtgattcagggaacagccagcgagtcgactctggtagctctgctgggcgccaag
gccaagaagatacagcaggttaagaaggaacatccagagtgggatgagcacacaatcatt
ggcaagttggtgggctattcctcggcccaggctcattcctctgtggagcgagctggtctc
ctgggcggcgtcaagttgcgttcagttccggctgatgagcacaatcgtctgcgtggcgat
gccttggagcaggcaatcaaagaggatttggctgctggcctaatacccttctacgctgtt
gtcaccttgggcacgactaactcgtgtgcctttgatcgactggatgagtgcggtgctgtg
gccaacaagtacaacgtgtgggttcatgtggatgcggcctatgctggctcagcattcatc
tgccccgagtaccgtcaccacatgaagggcatcgagacggccgactcgttcaacttcaat
ccacacaaatggatgctggtcaacttcgactgctcggccatgtggctgaaggaccccagc
tgggtggtaaacgctttcaatgttgatcccctgtacctaaagcacgacatgcagggctct
gcacctgactatcgtcactggcaaatcccattgggtcgccgtttccgcgccctcaagctc
tggttcgtgctgcgtctgtacggtgtcgagaatctgcaggcacatatcagacgccactgc
ggctttgccaagcagtttggcgatctctgccagcaggacaagcgcttcgagctggctgct
gaagtgagcatgggtttggtttgcttccggctgaagggcagcaacgagcgcaacgaagcg
ctgctcaagcggattaatggacgtggcaacattcacatggtgcccgctaaaatacgtgat
gtttacttcttacgcatggccgtctgctcgcgcttcacacgatccgaggacatggagtac
tcctggaaggaagtcagcgctgcagccgatgagctggaacagtctgaggcagatgaaaag
cagtaa

DBGET integrated database retrieval system