KEGG   Drosophila arizonae: 108611654Help
Entry
108611654         CDS       T05886                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
daz  Drosophila arizonae
Pathway
daz00511  Other glycan degradation
daz00600  Sphingolipid metabolism
daz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    108611654
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    108611654
Enzymes [BR:daz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     108611654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 108611654
NCBI-ProteinID: XP_017859893
Position
3
AA seq 951 aa AA seqDB search
MASGNDAAAGDSASAVYAEQLQQEKEHEREPEPNELTAVPRYGLKLKFDHVWPEKRNQNL
RPSIKQSLPMVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIGGIGGGSIGRG
YAGEFCRFQMRPGIYEYNVVHANQFIVTIKDHKGCTIFQSLLSRCSTKSFRAKTKTPSTN
NNDIDASTDEAEAQSTKCQLPHCSCSRNRQPLSTWHSNIEDSRCSYTGLYPRAWTEYDLS
HYGVRLICRQISPVIPHDYKESSLPCAVFVWSVQNVCDQERKVSITFTFKNGTGNKKLDA
EGNPESQLIAEGNAKGVAIRQTIADMPCSYNLACRVLPEISITRCPQFDPAGSGEQLWAQ
LKEYGQLNEQPTSETLKTKDIGVAVCAQLALKPQASHELEFVLAWDMPKIQFPRKLQTHT
RYYTKYFDDSGECGPRICEYALKHYASWERLIDAWQRPILNDEGLPDWYKCAIFNQLYYI
SDGGTIWLKCDSSLGNQLAFDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPN
LQVSLQYDFKDAIGAELNDTRKMLYDGKVMPRKIKNCVPHDLGDPDEEPFTLINCYNIHD
VNDWKDLNTKFVLQVYRDYYVLNELAQAQADNASKFSSIEFIDKESLYEQYSQDNNRKSS
ADGKQQNRKSASMYINETNGKVYLMDAMVYLKSMYGACKAIMERTIEYDKDNDGLIENTK
MPDQTYDAWVMDGPSAYCSGLWLAALQAMSVMATLLDQPNDCLRYQDILEKGKRSLEEKL
WNGSYYRFDLSHNHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFH
DGNIGAANGFIANASEPSKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFDEAFQTAGG
MYKTLSQRIGMNYETPEALYGEKRYRSIGYMRPLSIWSMQVAWERRRALRD
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggccagtggcaacgatgcagccgctggggattcggccagcgccgtctatgcagagcaa
ctgcaacaggagaaggagcatgaacgggaaccggaaccaaatgaactaaccgctgtgccg
cgctacggcttgaaactgaagttcgatcacgtttggccagagaaacgcaatcagaattta
cggccatcgataaaacaatcgctgccgatggttccgctcgtttgcagatatgctgcctac
tattggaaggtgtcgcgcgaaggtcgtcgcgtctatatggactactactacatggagaat
ggcaaacagatctatggcgtgcccattggcggcatcgggggcggcagcattgggcgtggc
tatgctggagaattctgtcgctttcaaatgcgcccaggcatctatgagtacaatgtggtg
catgcgaatcagtttatagtaaccatcaaggatcacaaaggttgcaccatatttcagagt
ttgctctcccgatgcagcacgaaatcattcagggcaaagacaaagacaccaagcaccaac
aacaacgatattgatgcctcgaccgatgaggccgaggcacagagcactaaatgtcaactg
ccccattgcagctgcagccggaaccgacagccgctgagcacttggcactcgaatatcgag
gactcacgctgcagctatacgggtctgtatccgcgcgcctggaccgaatacgatctctcg
cactatggcgtccgtttgatatgtcgccagatctcgccggttataccgcatgactacaag
gagtcgagtctgccgtgcgccgtcttcgtgtggtcggtgcaaaacgtttgcgatcaggag
cgcaaggtctccatcacgttcaccttcaagaacggcacgggcaacaagaagctggatgcg
gagggcaatcccgaatcgcagctcatcgccgagggcaatgccaagggcgtggccattagg
caaacaattgccgacatgccctgcagctataatctcgcctgtcgcgtgctgcccgagatc
agcataacgcgctgtccgcaattcgatccggctggcagtggggagcagctgtgggcccag
ctcaaggaatacggccagctcaacgagcagcccacgtcggagacgcttaaaactaaggac
ataggcgtcgctgtctgcgctcagctggccctcaagccgcaggcatcgcatgagctggaa
ttcgtgctggcctgggacatgcccaagattcagtttccacgcaaactgcaaacgcacacg
cgctactacaccaaatacttcgatgacagcggcgagtgcggaccaaggatatgcgagtat
gcattgaagcactatgccagctgggagcgactcatcgatgcctggcagcggcccatcctc
aacgatgagggcctgcctgattggtacaagtgcgccatattcaatcagctctactacatc
tcggacggcggcacaatctggctgaagtgcgactcttccttgggcaaccagctggccttc
gatgatccgcgcttggcctacggccgctttggctatctggagggacatgagtacagaatg
tacaatacgtacgatgtgcacttctatgcctcgcccgctctggcccatctctggcccaat
ttgcaagtcagtttgcaatacgacttcaaggatgcgattggcgccgagctgaatgataca
cggaaaatgttgtacgacggaaaagtgatgccgcgcaagatcaagaactgtgtgccacac
gatctgggggatcccgatgaggaacccttcacgctcatcaactgctataacattcacgat
gtcaatgactggaaggatctcaatacaaagttcgtgctacaggtttacagggattactat
gtgctcaacgagctggcccaggcgcaggcggacaatgccagcaaattcagctcaatcgag
ttcatcgacaaggagagcctctacgagcagtacagccaggacaacaatcgcaagagctcg
gcggatggcaaacagcagaatcgcaaatctgcttccatgtacatcaatgagacgaatggc
aaggtttatctgatggatgccatggtctatctgaagtccatgtacggcgcctgcaaggcc
atcatggagcgcaccattgagtatgataaggataacgacggactcattgagaacaccaaa
atgccggatcagacctacgatgcatgggttatggatggacccagcgcctattgctccggc
ctctggctggctgcactgcaggctatgtctgtgatggccacgctcttggatcagccgaac
gactgcttgcgctaccaggacatattggagaagggcaagcgttcgctggaggagaagctg
tggaacggcagctactatcgcttcgatttgtcgcacaatcatcgcgacacgatcatggcc
gatcagctgtgcggccattggtatttgaagtcgtgcggctttgattatgagatctacccg
aaggagaatgtgcgcaccgccctgaaacgcatttacgacaacaacgtgatgggctttcac
gatggcaacattggcgccgccaatggcttcatagcaaacgccagcgaaccgtcgaagccg
ggccatgtggacaacagcaacattcaggcggaggaggtgtggccaggcgttgtctatgcg
ctggccgcaaccatgatacaggagggcatgttcgacgaggccttccagacagccggcggc
atgtacaagaccctgtcgcaacgcatcggcatgaactatgaaacgcccgaggcgctctat
ggcgagaagcgctatcgttccattggctacatgcgacccctgagcatttggtccatgcag
gtggcctgggagcgacgccgagcgctacgcgactaa

DBGET integrated database retrieval system