KEGG   Drosophila arizonae: 108612551Help
Entry
108612551         CDS       T05886                                 

Definition
(RefSeq) insulin-degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
daz  Drosophila arizonae
Brite
KEGG Orthology (KO) [BR:daz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:daz01002]
    108612551
Enzymes [BR:daz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     108612551
Peptidases and inhibitors [BR:daz01002]
 Metallo peptidases
  Family M16: pitrilysin family
   108612551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 108612551
NCBI-ProteinID: XP_017860963
Position
4
AA seq 386 aa AA seqDB search
MVIEKFSEIENKNVKVPEWPRHPYGEEQYGQKLKIVPIKDIRSLTISFTTDDLTQYYKSA
PDNYLTHLIGHEGKGSILSELRRLGWCNDLMAGHQNTQNGFGFFEIVVDLTQEGLAHVDD
IVNIVFQYLCMLRKEGPKKWIFDECVKLNEMRFRFKEKEQPENLVTHAVSSMQIFPLEEV
LIAPYMSNEWRPELVCNLLNELVPSKSRISLVSQSFEDSTDMTEPYYKTKYGLERIPQCT
IERWECCDVNENLKLSLPNSFIPNNFDIAEVPSDAPIHPTIIMDTPILRVWHKQDNQFNK
PKACMTFDMSNPIAYLDPLNCNLNHMMVMLLKDQLNEYLYDAELASLKLNVTTKPGGIDF
TIRGFNDKQVVLLEKLLDHLFNFSID
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcgaaaaattctcagaaatagaaaataagaatgtaaaggtgccggaatggccc
aggcatccgtatggcgaggagcagtacggccagaagttaaagatcgtgcccattaaggat
atacgctcgctaacaataagctttacgaccgacgatctgacccagtactacaaatcggcg
cctgacaactatttaacgcatcttattggmcacgaaggcaagggyagcatattatctgag
ctgcgraggcttggctggtgcaatgatcttatggctggtcatcagaacacccagaatggc
tttggattcttcgagattgtggtggatctaacgcaggagggcttggctcatgtagatgac
attgtgaacatagtatttcagtatttgtgcatgctgagaaaggagggacctaagaaatgg
atatttgatgagtgtgtgaaattaaacgaaatgcggttccgtttcaaggagaaggaacaa
ccagagaatctcgtcacccatgcagtatcatccatgcaaatatttccactggaagaggtg
ctaattgcaccttatatgagcaacgaatggcgtcccgaattagtttgcaatcttttgaac
gaattggtgccatcaaagagtcgcatttccttggttagccaaagttttgaggattctacc
gatatgacagagccctattacaaaacgaagtatggcttggagcggataccccagtgcaca
attgagagatgggagtgttgtgatgtaaatgagaatctaaagctgtcactgccaaacagt
tttataccgaacaatttcgatattgccgaagtgcccagcgacgcaccaatacatcccaca
attataatggatacgccaattctgcgagtgtggcacaagcaggacaatcaatttaataag
cccaaagcttgcatgaccttcgacatgtccaatccgattgcctatttggatccactgaat
tgtaatttaaatcacatgatggtaatgctgctgaaggatcaactgaacgaatatctatat
gacgcagagctagccagtctcaagctaaacgtaacaaccaaaccaggcggcattgatttt
actatacgtggcttcaacgacaagcaggtggtattgcttgaaaagctcttggatcacctg
ttcaattttagcatagac

DBGET integrated database retrieval system