KEGG   Drosophila arizonae: 108612744Help
Entry
108612744         CDS       T05886                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
daz  Drosophila arizonae
Pathway
daz00010  Glycolysis / Gluconeogenesis
daz00562  Inositol phosphate metabolism
daz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108612744
   00562 Inositol phosphate metabolism
    108612744
Enzymes [BR:daz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108612744
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108612744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 108612744
NCBI-ProteinID: XP_017861216
Position
4
AA seq 464 aa AA seqDB search
MRLLLLLTMACLAYAQQQQDYCFGKDTERPQTRQFSSKTAYQIVKGTNMDKQYQVPGCEP
KKMWIYHRHGTRLPTPGTIREAPRLEELRDAIIKNYRVLRTKPDENALCLIDLTAIQMWK
WNASITVDIEEHLTSQGYEDMRGTAKLYQRYYPTVLPSKYNDSYYLFRHTDTQRTTESFK
GFAEGLFGDASVATAADIPEKDLLLRPYDYCSDFKDKNYKGEGSEYQKFRTSAIWNRTMA
DITKRLGFTFLAEDDIKLMFDICRYEQAWRVDRTSVWCGVFLPEQVTVLEYAEDLKYYYG
SGYGFEENTRFNCRAVQDMVARLSSPVSPHVVAYFAHSSGLQTLLTALGINKDDIKLRAD
NFDSMGSRRWKTSQLGPFAANFVGVKYHCPASLEKEKVVFFLNQNAVQLDWCNVGLCNWS
DVLAQYKTILEADCDEYYCRSAASVGRASMLVTGLIAAIVYLMH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgcttttgctcctgacgatggcctgcctggcctatgcccagcagcagcaggac
tactgcttcggcaaggatacggaacggccacagacccgccagttcagctcgaagacggcc
taccagatcgtcaagggcaccaacatggacaagcagtaccaggtgcccggctgtgagccg
aagaagatgtggatctaccacagacacggcacacgtctgcccacaccaggcaccatcagg
gaggcgcctagactagaggagctacgcgatgccattatcaaaaactatcgcgtgctccgc
accaagcccgatgagaatgctctctgcctcatcgatctcactgccatccagatgtggaaa
tggaatgcgagcattacggttgacattgaggagcatttgaccagccagggctacgaggat
atgcgcggcacagccaagctctaccagcgctactatcccacagtgctgcccagcaaatac
aatgatagctactatttgttccgtcacacggacactcagcgcaccacggagagcttcaag
ggctttgccgagggtctcttcggagatgcgagtgtggccaccgctgcggatatacccgaa
aaggatttgctgctgcgtccctatgactactgctcggacttcaaggacaagaactacaag
ggcgagggctccgagtatcagaaatttcgtaccagcgccatctggaatcgcaccatggct
gatattacgaaacgacttggcttcacattcctagccgaggatgacatcaaattgatgttc
gatatctgccgctatgagcaggcctggcgggtggatcgcacgagcgtctggtgcggcgtc
tttctgccggagcaggtgaccgtgctggaatatgccgaggacctgaagtactactatggc
tcgggctacggcttcgaggagaacacccgcttcaattgccgtgccgtccaggacatggtc
gctcgtctgagcagtcccgtttcgccacatgttgtggcctacttcgcgcactcgtcgggc
ctgcagacgctgctcacggcgctgggcatcaacaaggatgacatcaagctgcgagcggat
aacttcgattccatgggcagtcgccgctggaagaccagccagctgggtccctttgccgcc
aactttgtgggcgtcaagtaccattgccccgcctcgctggagaaggagaaggttgtcttc
ttcctcaatcagaatgccgttcagctggactggtgcaacgtgggcctgtgcaactggtcg
gacgtactcgcccagtacaagaccattttggaggccgactgtgatgagtattactgtcga
tcggctgcatcggtgggacgtgcctcgatgctagtcaccgggctaatcgctgccattgtc
tacttaatgcattag

DBGET integrated database retrieval system