KEGG   Drosophila arizonae: 108614578Help
Entry
108614578         CDS       T05886                                 

Definition
(RefSeq) protein piccolo
  KO
K12567  titin [EC:2.7.11.1]
Organism
daz  Drosophila arizonae
Brite
KEGG Orthology (KO) [BR:daz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:daz01001]
    108614578
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:daz04131]
    108614578
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:daz04812]
    108614578
   04147 Exosome [BR:daz04147]
    108614578
Enzymes [BR:daz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108614578
Protein kinases [BR:daz01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108614578
Membrane trafficking [BR:daz04131]
 Others
  Actin-binding proteins
   Others
    108614578
Cytoskeleton proteins [BR:daz04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108614578
Exosome [BR:daz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108614578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 ig Ig_2
Motif
Other DBs
NCBI-GeneID: 108614578
NCBI-ProteinID: XP_017864245
Position
4
AA seq 1439 aa AA seqDB search
MGNQPGKLQTPQSGRPKKNVHWKSAERPSPPGRPILTPLALSEQQPDVVNLRWERPLLDG
GSPIIGYTVEQRRVGSPHWVRATPTPISGCEIQISGLEPGWRYEFRCFAENIVGRSNASE
LSDPLTVTLQRNAISVPRFVEELTDMDAVEDERIEFRVRVLGEPPPEINWFKDGYEIFSS
RRTKIVNELDCSVLIIHQVALTDEGEIKCSATNRAGHVVTKCRLKVQAPPKIRLPRTYED
GLIVEAEEVLRLKVGVAGQPAPAITWLHEGEVIVPGSRFEVTNTEKNSLLKIDNVQRADR
GEYMVRAWNKLGEDIASFLVTVTARPNPPGAPRLNMSFGKSATLSWTAPLDDGGCKIGNY
IVEYFRIGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSEESELLFIPD
PKRGITKPKSATKIAGDERNDAGHKEKDKDISKPVPPRRKTLSPPRPQADAATSMSASPK
QSPRGSRKPTPQLVDSEQLRHEMSYGTSDQALKMSVRKSPSLSSADSAAVQTKATKPDSN
PKLNLTLITTTALADKPEPQSKPPKSPPAAVPLKLFNVKPMTDAKDKSPGRPSQKSKPQT
QPQPLPQPPIAALEPALDSSQRQPAPLRKSPTPPQPIKSTPALQRSAEPVQLGVNQNVRR
FSGHSLSPAKNVPALAIAIATSAHIGEPLPTIEISAPPPAQPEPLVPATPTSEPTPPVTK
VRPPKPADKHDEVHTSNEFMLVVFDKNSKVKDKDKQDSFELELEDAIQPPPISISAPDLA
FLEFTNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQASKAKAKTARAQEPAAIAVTA
PTTFRKRLGSMTEAERASFERRSELRRQSADMVPMGRKWDSRENVNLVDLKNLTRANTEQ
LLNLQARNTDSREQDVEDYDEDRTESTADDSEDLDMDEEQQQQQGFDLGTDYTESTATSD
QDSIEKFKMQLMARTHSPSPRDLETYHPRNMGTGTFTPYRAPTPEQAAVVLNRPMPLPSP
DFVPKPILKRSSNEHVELTLSQPSSPDAQQQELGNGAVSSPSTPAAAPSNLKLDLAKGIK
SFFSRDKRSATEKNTEANEEISNPLEKTNAAVIAAELETKRKIKEEEELRRQEQERLMQE
EAHAAVDHYSDLVRQVSSTHKYHTPLYLDRDELKRAAAQAGEDDDDDDGAAAEHQQRRAR
SPDQDELLLAPPTVSRERRLSISEREQLVHVRDAASKHAMHKAPETPAHEDQRGEEEPEF
PTVLVVPPPKSKNKKDAEECAESVMSEIVEARPDARGRTRLVKVKRVIKRRVPSRTRSRD
VSLSRPQQPLATGGSSLSQEHSSQAALLLSAADRELLEKAASLALLQSCSEEQAHEKVRS
ALSYSTDLVLFLVACYVYLFKDARLVLPILALMIYRQLGEAVRGYIPSWLRRKGNDGAA
NT seq 4320 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccaaccgggtaaactgcagacgccacagagtggacggcccaaaaagaatgtg
cattggaaatctgcagaacggccctctccgccgggtcgtcccatattgacgccactggcg
ctctccgagcagcagcccgatgtggttaatctgcgctgggaacgcccgctgctggacggt
ggctcgcctattatcggctatacggtggagcagcgacgcgtcggctcgccccactgggtg
cgtgccacacccacgcccatctccggttgcgaaattcagatcagtggcctggagccgggc
tggcgctacgaatttcgttgctttgccgagaacattgtgggtcgctcgaatgccagcgag
ctgtccgatccgctgactgtgaccttgcagaggaacgcaatcagtgtgccccgctttgtg
gaagagttgacggacatggatgccgtcgaggatgagcggatcgagttccgcgtgcgagtt
ctgggcgaaccgccgccagagatcaattggttcaaggatggctacgagatcttcagcagt
cgtcgcaccaaaattgtcaatgagctcgattgtagtgtgctgattatacaccaggtggcg
ctgaccgacgagggcgagatcaagtgctcggccacgaatcgtgcgggtcatgtggtcacc
aagtgtcgcctgaaggtgcaggcaccgcccaagattcgtctgccgcgcacctacgaggat
ggcctcatcgtggaggcggaggaagtgctacgtttaaaggtgggcgtggcgggacagcca
gccccagccatcacctggctgcacgagggcgaggtcatagtaccgggcagtcgtttcgag
gtcaccaacacggagaagaactccctgctgaagatcgacaacgtgcagcgcgcagatcgg
ggcgagtatatggtgcgagcttggaataagctgggcgaagatatcgcctccttcctggtc
accgtgacggccaggccgaatccgccaggtgctccacgcctcaacatgtcctttggcaag
tcggccacgttgtcgtggacagctccgctggacgatggcggctgcaagatcggcaactat
atcgtggagtactttcgtattggctggaacgtttggctaaaggcagccaccacacgggcg
ctgagcaccacattgcacgatctgattgagggctccgagtacaagtttcgcgtaaaggcg
gagaatccatacggcttgagtgagccatcggaggagtcggaattgcttttcatacccgat
ccgaagcgtggcatcaccaagcccaagtcggccaccaaaattgctggcgatgaacgcaat
gacgctgggcataaggagaaggacaaggatatatcaaagcctgtgccgccgcgccgcaag
acgctgtcgccgccacgcccacaagcggatgcggcgaccagcatgtccgcttcgcccaag
caatcgccgcgtggttcgcgcaagcccactccacagctggtggacagcgagcagctgcgc
cacgagatgtcctacggcacctccgaccaggcgctgaaaatgagtgtacgcaagagccca
tcgctgagcagcgccgactcggctgcagtgcaaaccaaagccaccaagcccgactccaat
cccaagctcaatttgacgctgataacaacaacagcgctggcggacaagccggagccacag
tccaagccacccaaatcacccccagctgcagtgccgctgaagctcttcaatgtcaagccg
atgactgacgccaaggacaagtcacctggtcgcccatcacagaagtcgaagccgcagacg
cagccgcagccactgccgcagcctccgatagcagcactggagcctgccttggattcgtct
cagcgtcagcctgctccactgcgaaagagtccaacgccgccgcagcccatcaaatcgacg
cccgccctgcagcgcagcgctgagcccgtccagctgggcgtcaatcagaatgtgagacgc
ttctctggtcactccctgagcccggccaagaatgtgccggctctggcaattgccatagcc
accagtgcccacattggcgaaccgctgcctaccatagagatcagtgccccgcctcctgcc
cagcctgagccacttgtgccggcgactcccacatcggagccgactccaccagtgacaaag
gtgcgtccaccgaagccagcggataaacacgacgaagtccatacgagcaatgagttcatg
ctagtggtcttcgacaagaacagcaaggtcaaggataaggacaagcaagattcctttgag
ctggaactggaggacgccatacagccaccgccgatctccatctctgcaccggatttggcc
ttcttggagttcaccaacttgcacacgactttcccgctgcgccgctcggtcagctccacg
gagctcctctacgaacgtgccatggcgcgtttctatgaagccgtggaattggagcaagcc
tccaaagcaaaggcgaagactgcaagggcccaggagccggcagccatagccgttaccgct
ccgactacgttccgcaagcgcctgggctctatgacggaggcggagcgtgcttccttcgag
cgccgcagcgagctgagacgccagtcggctgacatggtgcccatgggacgtaaatgggac
tcacgggagaacgtgaacctcgttgacttaaagaatctgacacgtgctaacacggaacag
ctgctcaatctgcaggcaagaaacactgatagtcgtgaacaggatgtggaggattacgac
gaggatcgcacggagagcacagccgatgacagcgaggacttggacatggacgaggagcag
cagcagcagcagggcttcgacttgggcactgattataccgagagcaccgccacctccgac
caggactccattgagaaattcaaaatgcagctgatggcgcgaactcactcacccagtcca
cgtgatctggagacgtatcatccgcgcaacatgggcactggcaccttcaccccctatcgt
gcacccacaccggagcaggcagctgtggtgctcaatcgaccaatgcctctgcccagtccg
gactttgtgccaaagcccatattgaaacggtcatccaatgagcacgtggagctcaccctt
agccagcctagcagcccggatgcacagcagcaggagctgggaaatggcgctgtcagcagc
ccttccactcctgctgcagcgcccagtaatttgaaactggatctggcaaagggcatcaag
tcgtttttcagccgggacaagcgctcggccaccgagaagaacaccgaggccaacgaggag
atctcgaatccgctggagaagaccaacgctgctgtcatcgctgcggagctggagacgaaa
cgcaaaataaaagaggaggaggagctgcggcgccaggaacaagaacgattgatgcaggag
gaggcacacgcagccgtggatcactacagcgacctggtgcgccaggtgagcagcacccac
aagtaccacacgccgctctacctcgaccgagatgaactgaagcgagccgctgcccargcg
ggggaggacgacgacgacgacgatggtgccgcagcggagcatcagcagcgtcgagcacgc
agtcccgatcaggatgagctgctgctggctccgcctaccgtaagtcgggagcgacgtctg
tccatttcagagcgggagcagcttgtgcatgtgcgtgatgcagccagcaaacatgccatg
cacaaggcgcccgaaacacctgcacatgaggatcagcggggggaggaggagccggagttt
cccactgtgctggtggtgccgccacccaagtccaagaacaaaaaagacgccgaggagtgc
gctgagagcgtgatgagcgaaatagtcgaggcgcgtccggatgctcgtggacgtacgcgt
ctggtaaaggtcaagcgtgtgatcaagcgccgtgtgccctcgcgcacgcgctcccgcgac
gtctcactcagcaggccacagcagccgctcgcaaccggaggtagctcgttgtctcaggaa
cacagctcccaagcggcattgctgctgtccgccgcggatcgtgagctgctggagaaggca
gccagcttggcgctgctgcagtcctgctccgaggagcaggcgcatgagaaggtgcgctcc
gccttgagctactccacggatctggtgctcttcctcgtagcctgctatgtctatttgttc
aaggacgcacgcctcgtcctgcccatcttggcgctgatgatctatcgccagctgggcgag
gccgtgcgtggttacatccccagctggctgcgacgcaaaggcaacgatggcgctgcctga

DBGET integrated database retrieval system