KEGG   Drosophila arizonae: 108614754Help
Entry
108614754         CDS       T05886                                 

Definition
(RefSeq) heat shock protein 68-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
daz  Drosophila arizonae
Pathway
daz03040  Spliceosome
daz04141  Protein processing in endoplasmic reticulum
daz04144  Endocytosis
daz04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:daz00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108614754
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108614754
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108614754
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108614754
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:daz01009]
    108614754
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:daz03041]
    108614754
   03009 Ribosome biogenesis [BR:daz03009]
    108614754
   03110 Chaperones and folding catalysts [BR:daz03110]
    108614754
   04131 Membrane trafficking [BR:daz04131]
    108614754
   03051 Proteasome [BR:daz03051]
    108614754
   03029 Mitochondrial biogenesis [BR:daz03029]
    108614754
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:daz04147]
    108614754
Protein phosphatases and associated proteins [BR:daz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108614754
Spliceosome [BR:daz03041]
 Complex B
  Other components
   Prp19 complex
    108614754
 Complex C
   Prp19-CDC5 complex
    108614754
Ribosome biogenesis [BR:daz03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108614754
Chaperones and folding catalysts [BR:daz03110]
 Heat shock proteins
  HSP70 / DNAK
   108614754
Membrane trafficking [BR:daz04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108614754
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108614754
Proteasome [BR:daz03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108614754
Mitochondrial biogenesis [BR:daz03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108614754
Exosome [BR:daz04147]
 Exosomal proteins
  Proteins found in most exosomes
   108614754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 DUF1843
Motif
Other DBs
NCBI-GeneID: 108614754
NCBI-ProteinID: XP_017864494
Position
2
AA seq 317 aa AA seqDB search
MDKSQIHDIVLVGGSTRIPKVQSLLQNFFSGKSLNLSINPDEAVAYGAAIQAAILSGDQS
SQIKDVLLVDVAPLSLGIETAGGVMTKLIERNSRIPCKQSKTFTTYADNQPAVTIQVFEG
ERAMTKDNNVLGTFNLTGIPPAPRGVPKVEVTFDLDANGILNVTAKEMSTGNAKNITIKN
DKGRLSQADIDRMVSEAEQYAEEDEKHRQRIAARNQLESYIFGVKEAAENAKDKISQSER
STVLDTCSEAIKWLDANTTAEKEEYEYKLQELTKVCSPVMTKMHQSAGGGDGPQASHCGQ
QARGCNGSGGPTIEEVD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggacaagagccagattcacgacatcgtcttggttggcggctcgacacgtattccgaag
gtgcagagcctgctgcagaacttcttctcaggaaagagcctcaacctgtctatcaatccg
gacgaggcggtggcctacggagccgccattcaagctgccattcttagtggagaccagagt
agccagatcaaggacgtgctgctggtcgatgtcgcgccgctctcactgggcatagagaca
gctggtggagtaatgacgaaactgattgagcgcaacagccgcattccttgcaagcagtcg
aagaccttcaccacatacgcggacaaccagcccgccgtgacaattcaggtgtttgagggc
gagcgcgccatgacaaaggacaacaacgtgctgggcactttcaatctgaccggcattccg
ccagctccgcgcggtgtgccaaaggtggaagttaccttcgatttggacgccaacggcata
ctcaatgtgacagccaaggagatgagcactggcaatgccaagaacataaccatcaagaac
gacaagggacgtctctcgcaagccgacatcgatcgcatggtgagtgaggccgagcagtat
gccgaggaggacgagaagcatcgccagaggattgctgctcgcaaccagctggagagctac
atctttggcgtaaaggaggctgccgaaaacgctaaagacaagatttcgcagtcggagcga
agcaccgtgctggacacgtgcagcgaagcaatcaagtggctcgatgctaataccacagcc
gagaaggaggagtacgaatacaaactgcaggaactcacaaaagtctgcagtcctgtgatg
acgaagatgcatcagtcagctggaggcggcgatggtcctcaagcgtcccactgtggtcaa
caagctagaggctgcaatggtagcggtggccccaccattgaggaggttgattaa

DBGET integrated database retrieval system