KEGG   Drosophila arizonae: 108615175Help
Entry
108615175         CDS       T05886                                 

Definition
(RefSeq) pyruvate carboxylase, mitochondrial-like isoform X1
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
daz  Drosophila arizonae
Pathway
daz00020  Citrate cycle (TCA cycle)
daz00620  Pyruvate metabolism
daz01100  Metabolic pathways
daz01200  Carbon metabolism
daz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108615175
   00620 Pyruvate metabolism
    108615175
Enzymes [BR:daz01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     108615175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 Biotin_lipoyl_2 HlyD_D23 ATP-grasp_4 RnfC_N ATPgrasp_ST OAM_dimer NQRA
Motif
Other DBs
NCBI-GeneID: 108615175
NCBI-ProteinID: XP_017864976
Position
5
AA seq 1197 aa AA seqDB search
MFLPESQAAFRTLRKAIPRVRLYFINKNAYSTQVEYKPIRSVLVANRGEIAIRVFRACTE
LGIKSVAIYSEQDKMHMHRQKADESYMVGKGLAPVEAYLNIPEIIRVCKENDIDAVHPGY
GFLSERSDFAQAVIDAGLRFIGPSPKVVQNMGDKVAARIAAIEAGVPIVPGTDGPVTSKE
EALAFCQKHGLPVIFKAAYGGGGRGMRVVRKMEEVEENFERASSEAKAAFGNGAMFIEKF
IERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPRLPVETRDKMTEAAVRL
AKHVGYENAGTVEFLCDESGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRIAEGMTLK
ELGLTQENVVPRGFAIQCRVTTEDPANDFQPNTGRLEVFRSGEGMGIRLDSASTYAGAII
SPYYDSLLVKVISHASDLQSSASKMNRALREFRIRGVKTNIPFLLNVLENQKFLHGVLDT
YFIDEHPQLFKFSTTQNRAQKLLNYLGEVLVNGPQTPLATSLKPAEVNPHVPQVPLDLSP
EALEREKRGGAKVTEPPQGLRDIIVREGPAAFAKEVRSRKNLLLMDTTFRDAHQSLMATR
VRTHDLLKISPYVAHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKRIPNIPFQM
LLRGANAVGYTSYPDNVVYKFCELAVQTGMDIFRVFDSLNYLPNLILGMEAAGKAGGVVE
AAISYTGDVGDPKRTKYDLKYYTNLADELVKAGTHVLCIKDMAGLLKPESAKLLITAIRD
KHPDVPIHVHTHDTSGAGVASMLSCAQAGADVVDVAVDSMSGMTSQPSMGAVVASLQGTP
LDTQLDLADISEYSAYWEQTRTLYGPFECTTTMRSGNADVYLNEIPGGQYTNLQFQAFSL
GLGDMFEDVKKAYREANFVLGDIIKVTPSSKVVGDLAQFMVQNNLNGAQVVEKAEELSFP
KSVIEYLQGYIGIPYGGFPEPFRSRVLKDMPRIEGRPGAEMAPLDFDKLKAELSESHVNV
TERDVVSAALYPQVTNEFLHYREQFGPVDKLDTRIFLSGPKVGEEFEVTLERGKTLSMKA
LAMAADLKPNGKREVFFELNGQLRSVHIPDKEAMKEIRIHPKADKTVKGQVGAPMPGDVI
DVRVTIGDKVEKGQPLVVLSAMKMEMVVQAPQNGVVKKVEVKKGMKLDGDDLILIIE
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgccggaatctcaagccgcattcaggacgctgcgcaaagcgattcctcgtgtg
agactttacttcatcaacaaaaatgcctattccactcaggtcgaatacaaacccatccga
tcggtgctggtggccaatcgtggcgagattgcgattcgcgtgtttcgtgcctgcactgag
ttaggcatcaagtcggtggccatctactcggagcaggacaaaatgcacatgcatcgtcag
aaggccgacgagtcatatatggtcggcaagggcctggcaccggtggaagcctacctcaac
attccagagatcattcgcgtttgcaaggagaacgacattgatgcagtgcatcccggttat
ggtttcctctccgagcgcagcgactttgcccaggccgttatcgatgctggacttcgcttt
atcggcccctcgcccaaggtggtgcagaacatgggtgacaaggtggctgcgcgtattgcg
gctatagaagcgggtgttcccattgttccaggcacagatggcccagttacctctaaggag
gaggcattggcattctgccaaaagcatggtcttcctgtcatcttcaaggcagcgtacggc
ggtggcggccgtggcatgcgtgtggtccgcaaaatggaagaagtcgaggagaactttgag
cgtgccagctccgaggccaaggcggcctttggcaatggcgcaatgttcattgagaagttt
attgagcgaccccgccacattgaagtccaactgctgggcgataaggcaggaaatgttgta
catttatatgagcgtgactgctctgtgcagcgtcgccaccagaaagtggttgagatcgcg
cctgctccacgtctgcctgttgaaactcgcgacaagatgaccgaggcagcagtccggctg
gccaagcatgtgggatacgagaatgctggcactgtggagttcctgtgcgatgagtctgga
aacttctacttcatcgaagtgaacgccagattgcaggtggagcacacagtgactgaggag
attaccggcatcgatttggtacagtcgcagattcgcattgccgagggtatgaccctcaag
gagctgggactcacccaggagaatgttgtgccacgtggctttgctattcagtgccgtgtc
accaccgaggatcccgccaacgacttccagcccaacaccggccgcctcgaggtcttccgt
tccggcgagggcatgggcattcgtctagacagtgcctcgacctatgctggagctatcatc
tcgccctactacgattcgctgctggtcaaagtgatatcccatgccagtgatctgcagagc
tcagcgtccaagatgaaccgcgcactgcgtgagttccgtattcgtggcgtcaagacgaat
attcccttcctgctgaacgtgctcgagaaccagaagttcctgcacggcgtactggacacc
tactttatagacgagcatccacagctgttcaagttctctactacccagaatcgtgctcaa
aagctgctcaactatttgggcgaagtgctggtcaatgggccacagacgccattggcgaca
tccctgaagcccgccgaggtgaatcctcatgtgccgcaggtgccgctggatctgtccccg
gaagccttagaacgtgaaaagagaggcggggcaaaagtcacggagccaccacagggtctg
cgtgacatcattgtgcgcgaaggtcccgcagcatttgccaaggaggtgcgttctcgaaag
aacctactcctcatggacaccactttccgtgatgcccatcaatctctgatggccacgcgt
gtgcgcacccacgacctgctcaaaatatcgccatacgtggcgcacaagtttaacaatctg
tactcgctcgaaaactggggtggagccactttcgatgtagctctacggtttctgcacgag
tgcccatgggagcgcctggaagagatgcgcaagcgcattccgaacattccattccaaatg
ctgttgcgcggcgccaatgccgttggatacaccagttacccagacaatgtggtctacaag
ttctgcgagctagcggtgcaaactggcatggacattttccgagtgttcgactcccttaac
tacttgccgaacttgatcctcggcatggaggcggcaggcaaggcaggcggtgttgtagag
gcggccatctcctacaccggagatgtgggagatcccaagagaaccaaatacgatctcaag
tactacacaaacttggctgacgagctcgtcaaggcgggcactcacgtcctctgcatcaag
gayatggcgggtctkttraagccagagtckgctaagctgctgatcactgccatccgcgac
aagcatcccgacgttccaatccatgtycacactcatgacacctctggagccggtgttgca
tctatgctttcctgtgctcaggctggagctgatgttgtagacgtggccgtcgactcgatg
tctggaatgacctcgcagccaagtatgggagcggtagtcgcctctctgcagggcactccc
ttggacacacagctggatttggccgatatttccgagtattcggcgtactgggagcaaacc
cgtactctctacggaccgtttgaatgcaccacaacgatgagatcaggaaatgccgatgtc
tacctgaacgaaatccccggtggtcaatataccaatctgcagttccaggcgttctcccta
ggtctgggcgatatgtttgaggatgtcaagaaggcttaccgtgaggccaacttcgtgttg
ggcgacatcattaaggttactccgtcatccaaggttgtgggtgacttggctcagttcatg
gtgcagaacaatctgaatggtgctcaagtggttgagaaagccgaagagctctccttcccc
aaatcggtgatcgagtacctgcagggctatatcggtattccatatggcggcttcccagaa
ccattccgttcacgtgttctgaaggacatgccacgcatcgaaggccgacctggtgctgag
atggcgccactggactttgacaagctgaaggccgagctgagcgaatctcatgtaaatgtt
accgagcgtgatgttgtttcggcagcgctctatccacaggtgaccaatgagttcttgcat
taccgcgagcaattcggtcccgtcgacaagctggatacgcgcatattcctgtcaggcccc
aaagtaggcgaagagttcgaggttaccttagagcgcggcaagacgctgagcatgaaggcc
ttggccatggctgccgatctcaaaccgaatggaaagcgcgaggtgttcttcgaattgaac
ggccaactgcgctctgtccacattcccgacaaggaggctatgaaggaaatccgtattcat
cccaaggctgacaagacggtgaagggacaagtgggcgcccccatgcccggcgatgtcatt
gacgtgcgcgtgaccattggcgacaaggtggagaagggtcagcccctggttgtcctctcg
gccatgaaaatggaaatggttgtccaggcgccacagaacggcgttgtcaagaaggtggag
gtcaagaagggcatgaaattagacggcgatgacttaattttgatcatcgaataa

DBGET integrated database retrieval system