KEGG   Drosophila arizonae: 108616516Help
Entry
108616516         CDS       T05886                                 

Definition
(RefSeq) uncharacterized protein LOC108616516
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
daz  Drosophila arizonae
Pathway
daz00230  Purine metabolism
daz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108616516
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:daz01001]
    108616516
Enzymes [BR:daz01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108616516
Protein kinases [BR:daz01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   108616516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA DDRGK
Motif
Other DBs
NCBI-GeneID: 108616516
NCBI-ProteinID: XP_017867289
Position
2
AA seq 1759 aa AA seqDB search
MKLTICQIAKLFLLLTAFFFLNSHHASSASTTLNNTSGATSSNVFSSGQNLAPLTTAPAG
NVPKTLANATATTAVTSTATTATTTATTARATATATTTATAALRTSTASATATTTQQQRQ
LQQQQQQQQQSNAHELVRQARQQQDTAKQQQLQHPREQQQQQQLQQRQRRQHQKQQTTTA
AAVAAQRVAVLIPSSLHIDMMQVQQGFEHFVEFFQVHLSNASVDFIQDVDLSGFIKLLEL
PKYTSVVKTLNAGINIDTDVDLDDDGDGADPTKQPSQQRTQMKQLSADTLSAPTGRPKEQ
QQKHQKQQQNDKAQKEKEREKQKQQQQQQHSDTSSLAHCHQLAEQLAYDYNKSALFWPCP
QMKISSNFLPSFEAISLAVRSIASKLNWLHVDIYVGDDNWGLPLAIAANLHIPYRIEIGD
TVRDLHEQDKPGQAIIITAPLNDVSTLRWLRRGKWTDRDQQTRVLLIDMVASSLNVEHRL
YKYLARINAATRNGNGNGHNSSNSNSNSNGNGNGNSNGNDSVSSSGIDNGNSSSMPKLPG
SGLVTSNLLVLTLLSDKHRHYLNAAGIGMAMVHNFRTPASELLLSDAEATMEALAHQNAS
LNRLRPFMNLFSLYDLLLSHITTGNATAGKPKYDFLVLDIVVDAALASYKWRPLLILEGD
KALGQSGSYITHSIQPGYDEWLLVSNAQIWHCGAICWTIAAICIGLLIIIVAASVAAGIA
VRNYFLRKRLSKGPNKIVLSASDFVFPVDSRRVDEGIEAMLCCWLQQLQEFGGPEVDKPD
LLKGSIGSLKNLGFVIPGATAGGNSGALAGAGGTATGGAVNGKSGTSASGSLARHKPAHL
DMRARYNGDLVQLKEIPLNGSAELRSKAMDLLVMAHGLRHENINPLIGWLSDPSRTAMVF
DYCSRGSLQDVLIMDEIKLDWSFRLSLLTDLVRGMRYLHASPLRIHGALTSRNCVVDARW
VLKITDYGLNSFYEMQGLAQVPRSNKELLWTAPELLRTMKTQPQQQHHHHHHHQHGRVQM
GTQMGDVYSFGIIMQEVVVRGEPYCMLSLSPDEIIAKLKKPPPLIRPSVSKGAAPPEAIN
IMRQCWAEQPDMRPDFNSVYERFKMLNHGRKVNFVDTMFQMLEKYSNNLEELIRERTDQL
DIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGFTTIAAHCSPVQVV
DLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRF
NVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQE
TRDRLEARGGYSIEPRGLIDIKGKGMMNTFWLLGKKGFEKPLPVPPPIGESHGLDESLIR
NSITLKAQANKSRTSTNPSSSQSSSLAGETVEVKVEITPPSNTDLGSSVLPNSYSLDSTS
TNTISPNTTLCPEFPNKTPSSTSPQSRKLSELTPDSLLNPNSFNRLPSSTGGSSSRLYKK
IEEMMDLSSPYNHYKCLSPSESNLTQFYDGKYMYGNSGGGSAAGNNGPGSGGCSVSGSTS
KFDSKPGSSRLLRRQFSLDRDDQQSKVEQQHQHSLQASNYAALMNASKNSMLDIPMLHDT
SRSPKGTLTRAHKQNSTSIAQDLEKIEEIPLSPASSQHHSSLDSNLNRSPPSTLEAQPPP
AKAMPASGAPLSPPLSSAPTSPAPSRTLNGFDAHRRSNKNNNNNSSSIRSESADSPHPAR
ESNMASPEIVLNVEQLLSR
NT seq 5280 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaacaatctgtcaaattgctaaattatttctgctgttgacagccttcttcttt
cttaattcccatcacgcctcctccgcctcaaccaccttgaataacacctctggcgccacc
agcagcaacgtcttttcatcaggccaaaatcttgccccactgaccacagcgccagctggc
aatgtgcccaagacattggcaaatgctactgcaacaactgcggttacgtccacggcaacg
acagcgacaacaacagcgacaacagcgagagcgacagcaacagcgacaacaacagcgaca
gcagcattgagaacctcaacagcatcagcaacagcaacaacaacacaacagcaaagacaa
ctacaacaacaacaacaacaacagcaacaaagcaatgcgcatgaattggtacgtcaagca
cgtcaacagcaagataccgcaaagcaacagcaactgcaacatccacgagagcaacagcaa
caacaacaactacaacaacgccaacgtcgccaacatcaaaaacaacaaacaacaactgct
gcagctgtcgcagctcagcgtgtagccgttttaataccttcgtcactgcacattgatatg
atgcaagtgcaacagggcttcgagcatttcgttgagttttttcaagtacatttatctaac
gccagcgtcgattttatacaagatgtcgatttaagtggcttcattaaattactggagcta
ccgaaatacacgagcgttgtaaagactttaaatgcgggcattaatatagacaccgatgtg
gacctcgatgacgatggcgatggcgctgacccaacaaagcagccaagtcagcagcgtacc
caaatgaaacagttgtcagcagacactttatcagcgcccacagggcggccaaaggaacaa
cagcagaaacatcaaaaacagcaacaaaatgataaagctcagaaggaaaaggagagggag
aagcagaagcagcagcagcagcaacagcactcggataccagcagcttggcccactgtcac
cagctggcggagcaactggcttacgattacaataagagcgctctcttctggccctgtcct
cagatgaaaatctcgagcaattttctgccatcatttgaggccatttccttggctgtgcga
agcattgccagcaagttgaattggttgcacgttgacatctatgtgggcgacgacaattgg
ggcctaccattggccattgcggccaacttacatataccttatcgcattgaaattggcgac
acagtacgtgacctgcatgaacaggataagcctggccaagcaattattattacggcccct
ctgaacgatgttagcacgctgcgctggctacgcaggggcaagtggactgaccgagaccaa
cagacgagagtattgctcatcgatatggtagccagctcattgaatgtcgagcatcgactc
tacaaatatttggcacgcatcaatgcggccactcgcaatggtaatggtaatggccataac
agcagcaacagcaacagcaacagcaatggcaatggcaatggcaacagcaatggcaatgac
agtgtcagttccagtggaattgacaatgggaatagtagcagcatgccaaagctgcctggg
tctgggctggtgaccagcaatctgttggtgctgactctgctaagcgataagcatcggcac
tatttgaatgcggccggtattggcatggcgatggtgcataattttcgtactccagcgtcc
gagctattgttgagtgatgcggaggcgacgatggaggcgctggctcatcaaaatgccagt
ctcaacaggctgcgtccctttatgaatctgttctcgctctacgatctgctgctgtcgcac
attaccactggcaatgcgacggctggcaaaccgaaatacgattttctggttctggacatt
gttgtggatgctgcacttgcctcgtacaaatggcgtcctctgctcatacttgagggtgac
aaggctctgggacaatcgggcagctatataacgcactccattcagccgggctacgatgaa
tggctcctggtcagcaacgctcagatttggcactgtggcgccatctgttggacaattgcg
gcaatatgtattggcttgctaatcatcattgtggcggccagcgtcgctgccggcatagcc
gtgaggaactactttctgcgcaaaagactgtcgaagggacccaacaagattgtactctcg
gccagtgactttgtgtttcctgtggactcgcgtcgggtggacgagggcatcgaggccatg
ctctgctgctggctacagcagctgcaggaatttgggggtcccgaggtggataagccagat
ttgctgaagggttcgattggctcgcttaagaatctgggctttgtcattcccggggcgaca
gcggggggcaacagtggtgcgctagctggagctggtggcaccgccactggtggagcggtt
aacggcaagagtggcacttcggcttcgggcagcctggctcgccataagccagcccatctg
gacatgcgcgctcgctacaatggcgatctggtgcagcttaaggagatacccttgaatggc
tcggccgagctgcgatccaaggccatggatctgctggtgatggcgcatgggctgcgacac
gagaatataaatccgctaattggctggctgtcggatccgagtcggacggctatggtcttc
gattattgctcgcgcggctcgctgcaggatgttcttatcatggatgagattaagctggac
tggtctttccgcctaagtctgttgactgatctggtgcgcggtatgcgctacctacacgcc
tctccgctgcgcatccatggcgcactgacctcccgaaactgtgtggtcgacgcccgatgg
gttctcaagattaccgactatggcctgaattccttctacgaaatgcagggcctggcccaa
gtgccacgcagcaacaaggagctgctatggacggcgccagagctgctgcgcactatgaaa
acacagccacagcarcaacaccatcatcatcatcatcatcagcatggacgcgtgcagatg
ggcacacagatgggcgatgtctactccttcggcatcatcatgcaggaggtggtggtgcgg
ggtgaaccctattgcatgctctccctctcgccagatgagattattgccaagcttaaaaag
ccaccgcccctaatcagaccctcggtctccaagggagcggcaccaccggaggccatcaac
ataatgcgacagtgttgggccgaacaaccagacatgagacccgattttaactccgtttac
gagcgcttcaagatgctcaatcacggacgcaaagtcaactttgtggacacaatgtttcaa
atgctggaaaaatactcgaacaatctggaggaattgatacgagagcggaccgatcagctg
gatatagagagaaagaaaactgagcagctgctgaatcggatgttgccaagctctgttgct
gagaagcttaaaatgggcttggccgttgatccggaggagttctcggatgtcacaatttat
ttcagtgacattgttggcttcacaacgatcgctgctcactgcagtccagtgcaggtggtg
gacctgctgaatgatctctacaccatattcgatgccaccatcaatgcttacaatgtatac
aaggtggagaccattggagatgcttatatggtcgtcagtgggctgcctgtgaagataccc
gatcacgccgagcagatagccaccatggcactggatctgctccaccagagcggacgcttc
aatgtgaagcatctgccgggcgtgccgctccagcttcgcatcggcctgcacacgggtcca
tgctgtgcgggcgttgtgggtctaacaatgccgcggtattgcctatttggcgatacggtg
aatacagcctctcgaatggaatctacaggctcctcttggcgcattcacatgtcgcaagag
actcgcgatcgcttggaggcacgcggcggatactcgatagagcctcgcggcctaattgat
atcaagggcaaaggcatgatgaacacattttggctgctgggcaagaaaggttttgagaag
ccattgccggtgccaccacctattggggagtcgcatggattggacgaatcactaatacgc
aactcgattacgctgaaggcgcaggcgaacaagtcgagaaccagcacgaatccgtcatcg
tcgcagagctcgtcgctggctggtgaaacagtcgaggtgaaggtggagataacgccaccc
tccaacaccgacttgggctccagtgtgttgcccaactcctattcgctggactcgacctca
acgaacaccattagtcccaatacgacgctgtgtccggagtttcccaataagacgcccagc
agcacaagtccgcagtcgcgcaagctgtcggagctgacgccggatagtctgctgaatccc
aacagctttaatcgcttgcccagctctacgggcggctctagctcccggctatacaagaag
attgaggaaatgatggatctcagctcaccgtataatcattacaagtgtctcagtcccagc
gagagcaacctgacccagttctatgatggcaaatatatgtacgggaattcaggtggcggc
agtgcggcgggaaacaatgggcctggcagtgggggctgctccgttagcggcagcacctcc
aagtttgacagcaagcccggctccagccgcctgctgcgtcgtcagttcagtctggaccgg
gacgatcagcagtccaaagtggagcagcagcaccagcactccctgcaggcaagcaactat
gcggccctgatgaatgccagcaagaactccatgctcgatataccgatgctgcacgacaca
tcccgcagtcccaaaggcactttgacgcgtgcgcacaaacaaaactcgacatccatagca
caggacttggagaagatcgaggagataccgctgtcgccggcctcctcccagcatcacagc
agcctagatagcaatctgaatcgtagtccaccctccacgctggaggctcaaccaccccca
gcgaaagctatgcccgcctctggtgccccgctcagtccgccgttgtcctcagcgccgacc
tcgccggcgccgtcgcgcacgctcaacggctttgatgcgcatagacgatcgaacaagaat
aacaacaacaacagcagcagcatcagaagcgagagcgccgacagcccccatccggcacgg
gagagcaacatggccagccccgagatagtcctgaacgtggagcaactgctcagcagatag

DBGET integrated database retrieval system