KEGG   Drosophila arizonae: 108617608Help
Entry
108617608         CDS       T05886                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 isoform X1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
daz  Drosophila arizonae
Pathway
daz00760  Nicotinate and nicotinamide metabolism
daz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    108617608
Enzymes [BR:daz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     108617608
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     108617608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 108617608
NCBI-ProteinID: XP_017868938
Position
2
AA seq 358 aa AA seqDB search
MSGFIEEKSFMLPRVALIACGCFSPPTPMHMRLFEIARDYFELRGTHKVVGGIISPTHDS
YGKKGLAPALDRCAMIKLAAQSSNWIRLSDWEVHQPQWMRTKAVLHYHQNYLNNYINSPY
DEEPNELLPGWLPPGLRERRDPIRLKLLCGADLLESFAVPGLWADEDIEEIVANHGLVVI
TRCGSNPEKFIFDSDILTKYQQNITLITNWVPNEVSSSLVRRLLSRGESVKYLLDDMVLN
YIKRQGLYNVKSKYITDAVRPDHLNFNRAYMDNNKNAIKPESEQPEQLMEDESDSPLRQQ
TARVFCCGESSRTSTKLLLSRPGPGQAVQVMTVQSKDTIDGLEQSQPKKQKIAKVQQV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtccggatttattgaggaaaaatcctttatgttgccccgcgtggcgctcatagcatgt
ggatgcttcagtccaccaacgccaatgcatatgcgtttgttcgagatagcacgagattat
tttgagcttcgtggcacgcataaagttgttggcggtataatatcacccacacatgactca
tatggcaagaaaggactggctccagcattggatcgctgcgccatgataaagctggctgct
caatcctcaaattggatacgcttgtccgattgggaggtacatcagccacaatggatgcgc
acaaaagcggtgctgcattatcatcagaactatttgaacaactacatcaattcgccatac
gatgaggagccaaatgagctgctacctggctggttgccaccgggattgcgtgaacgacgg
gatcccattcgtctcaaactgctatgcggagctgatttattagaatcttttgctgtgccc
ggcttgtgggccgatgaggatattgaagaaattgtcgctaaccatggattggtcgtcata
acccgttgtggctctaatcctgaaaagttcatattcgattcggatattctaacaaagtac
cagcaaaacataacgcttattaccaactgggtgcccaatgaagtgagctcttctctcgtt
cgtcgtcttctaagtcgcggagaatccgtgaagtatcttttagatgatatggtacttaat
tacatcaagcgccagggcttgtataatgtaaaatctaagtatataacggatgcagtgcgt
ccagatcatttgaatttcaatcgcgcatatatggacaataacaagaatgcaatcaaaccg
gaaagcgagcaaccggaacagctaatggaagatgagtcggacagtccgctcaggcagcag
acagcgcgtgtattttgctgcggcgaatcgtcgcgcaccagcaccaagctgctgctgagt
cgccctggtcccggtcaggcggtgcaggttatgacagtgcagagcaaggacaccatcgat
ggcttggagcaatcgcagcccaagaaacagaagatagccaaagtgcagcaggtctga

DBGET integrated database retrieval system