KEGG   Drosophila arizonae: 108618551Help
Entry
108618551         CDS       T05886                                 

Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
daz  Drosophila arizonae
Pathway
daz00740  Riboflavin metabolism
daz00860  Porphyrin and chlorophyll metabolism
daz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    108618551
   00860 Porphyrin and chlorophyll metabolism
    108618551
Enzymes [BR:daz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     108618551
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     108618551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD GDP_Man_Dehyd Semialdhyde_dh adh_short Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 108618551
NCBI-ProteinID: XP_017870103
Position
2
AA seq 207 aa AA seqDB search
MQRIAVIGGTGMTGQCVVDYALEKGLKVRLLYRTEPTVPERFKGKVQLVQGDVTNIEDVK
RLIEGDGVVDGVCVILGTRNKLEATTELSRGTENVIKAMKDANLRKFSIVMSSFLLRPLT
EVPAVFHKLNEEHQRMLDLTKASGLDYVAILPPHIADEPASSYTVVHDEAPGRLVSKEDL
AKFIVDSLDQPEHYGKVCGIAKSAKSA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcaacggattgcagtaattggtggcaccggcatgaccggtcaatgcgtagtggattat
gcattagaaaagggtctgaaagtgcgtttactttaccgcacagagcccaccgtgccggag
cgtttcaaaggcaaagttcaattagttcagggcgatgtaactaatattgaggacgttaag
cgtctgattgagggcgatggcgtagtggacggcgtttgcgttatactgggcacacgcaac
aaactggaggccacaacggagctatctcgcggcaccgagaacgtcataaaggccatgaag
gacgcaaatctcaggaagttttccattgtgatgtcgtctttccttttgcgtcctctaacc
gaggtacctgctgtattccacaaactaaatgaggagcaccagcgcatgttggacctgaca
aaagcatccggcttggactatgtggctatattgccaccacacatcgccgatgagccagcc
agtagctatactgtggtgcacgatgaagcacccggacgcttggtatccaaagaggacttg
gccaaattcattgtagattccttggatcaacctgaacattatggcaaagtttgcggcatc
gccaaaagcgctaagagcgcttaa

DBGET integrated database retrieval system