KEGG   Drosophila arizonae: 108621397Help
Entry
108621397         CDS       T05886                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase isoform X1
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
daz  Drosophila arizonae
Pathway
daz00510  N-Glycan biosynthesis
daz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    108621397
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:daz01003]
    108621397
Enzymes [BR:daz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     108621397
Glycosyltransferases [BR:daz01003]
 Glycan extension
  N-Glycan
   108621397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2 SR-25
Motif
Other DBs
NCBI-GeneID: 108621397
NCBI-ProteinID: XP_017874175
Position
2
AA seq 625 aa AA seqDB search
MSKMRGRVLIPLPNTGAMGRKRNNFYMRSIFILALCIFGLLQYHNFNYLDSRDAMLSESI
TNDSVDAIMSMVPATLHKYLTPHTRNHSISAAGLQLNSSGSSLGGSGSGAATTISFEVYR
PPNNTEIKRQIVRYNEMQLVLNEETFGPLQNDSVIIVVQVHTRINYLRHLIVSLAQARDI
SKSLLIFSHDFYDDDINDLVQQIDFCKVLQIFYPYSIQTHPREFPGVDPNDCPRNIKKEQ
ALMSNCNNALYPDLYGHYREAKFTQTKHHWWWKANRVFNELEVTRFHTGLVLFLEEDHYV
AEDFLYLLAMMQQRTKDLCPQCNILSLGTYLKTFNYYTYHSKTNKKSYASSLISSNSLLG
SNRNNYNNHNNNNNNNNNNNNNRNSQQLTASSSALSSSTSLKNAKVYVGDTSDVDNNNNS
NNNKNKNNKIMNNKKTSHMNTVTATSNKKNNNNNNDNSNKNGAQTWNYHVLPSLYSVYQK
VESMPWISSKHNMGFAFNRTTWTSIRRCARHFCSYDDYNWDWSLQHVSQQCLQRKLHAMI
VKGPRVFHIGECGVHHKNKNCESNQVISKVQHVLRIARNSHQLFPRSLMMTVPSLIKKSK
LRKGNGGWGDLRDHDLCLNMTLPTR
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatgagaggtcgtgtactgatacccctgcccaatacgggggcgatggggcgc
aaacgcaacaatttctacatgcgcagcatcttcatcttggccctctgcatcttcggtctg
ctgcagtaccacaattttaactacctggacagccgcgatgcgatgctcagcgaatcgatt
accaatgactccgtggatgccataatgtcaatggttcctgccacgctccacaagtatctg
actccacatacgcgcaatcatagcatctcggctgcaggtctccagctgaatagcagcggg
tcttcgttgggcggctcgggcagtggagcggcgacaaccatcagctttgaggtctatcgg
ccgccgaacaacacggagatcaagcgtcagatagtgagatacaacgaaatgcagctggtg
ctcaatgaggagacgttcgggccgctgcaaaacgattctgtgataattgtcgtgcaggtg
cacacgcgcatcaattacctgcgccatctgattgtgagcctggcgcaggcgcgcgacatc
tcgaaatctttgctgatcttctcgcacgacttctacgacgacgacatcaacgacctggtg
cagcaaatcgatttctgcaaggtgctgcagatcttctatccgtactccatacagacgcat
ccgcgcgagtttcctggcgtcgatcccaacgactgccccaggaacatcaagaaggagcaa
gctctgatgagcaactgcaacaatgctctatatcccgatctctatggccattaccgtgag
gccaagttcacgcagacgaagcaccactggtggtggaaggcgaatcgagtcttcaacgag
ctggaagtgactcgctttcacaccggtctcgttttgttcctggaggaggatcactatgtg
gccgaggactttctctacttgctggccatgatgcagcagcgcaccaaagacttgtgcccg
cagtgcaatatcctttcgctgggcacctacctaaagacattcaactattatacgtaccac
agcaagactaacaaaaaatcgtatgcttcctcgctgatctcgtcaaacagtctattagga
tcaaataggaacaattacaataaccacaataacaataacaataataataataataataat
aataatagaaattcacagcaattaactgcgtcctcatcagcgctatcatccagcacttca
ttaaagaacgccaaggtctatgtgggcgacacctcagacgttgataacaataacaatagc
aataataataagaataagaataataaaataatgaacaataaaaaaactagccacatgaac
actgtcaccgccacatcaaacaaaaaaaataataataataacaatgataatagcaataag
aatggtgcacaaacttggaattatcatgtactgccgtcattgtattccgtctatcagaag
gtggagtccatgccctggatcagcagcaagcataacatgggcttcgccttcaatcgtacc
acttggacgagcattagacgctgcgctcggcacttctgcagctacgatgactacaactgg
gattggtcgctgcagcatgtgtcccagcagtgcctgcagaggaagctgcacgcaatgatt
gtcaaggggcctcgagtctttcacattggcgagtgcggcgtgcatcacaagaacaagaac
tgcgagtccaatcaggtgatttctaaggtgcaacatgtgctgcgcatagcacgcaactcc
catcagctcttcccgcgctcgctgatgatgacggtgcccagtttgatcaagaaatcgaag
cttcgcaaaggcaacggcggctggggcgatttgcgcgatcacgatctctgcctcaacatg
acgttgccaacgagataa

DBGET integrated database retrieval system