KEGG   Desulfomicrobium baculatum: Dbac_2366
Entry
Dbac_2366         CDS       T00963                                 

Name
(GenBank) Formate C-acetyltransferase
  KO
K23121  trans-4-hydroxy-L-proline dehydratase [EC:4.2.1.172]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00330  Arginine and proline metabolism
dba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Dbac_2366
Enzymes [BR:dba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.172  trans-4-hydroxy-L-proline dehydratase
     Dbac_2366
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACU90446
UniProt: C7LR40
Position
2722035..2724395
AA seq 786 aa
MNQRIERLREESFAATPSISIERALLETAFYREHYGKHSLPVLRALVFKDLCEKKTIYLG
DGELIVGERGPRPKCVPTFPELTCHSAEDLRVLATRPMTSYHVSENDIATYEREVIPYWT
GRSMRERVFSRIPDEWRTAYEAGLFTEFMEQRAPGHTALDGTIYEMGLLDFKQRIAERLT
RLDYLSDPLASDRAEQLRAMDIACDAAVIFANRHADLAWELAKTEADPARKAELTRIAEV
CRHVPAHAPRDFWEALQMYWFVHLGTITELNGWDAMTPGHLDQHLAPFYAQGLADGTLTR
EAAKELLCCLWIKVNNHPAPPKVGVTAKESGTYNDFTNINLGGLRRDGSDGVSELSYLIL
EVVDELRLLQPQTSVHISQKTPDRFLKAAAQVIRNGYGYPSIFNTDAVVMEQMRVGKTVE
DAREGGCSGCIETGAFGKEAYILTGYLNVPKILELALNNGRDQLTGKQVGPRTGEPESFA
TFDDLYAAFTRQLDWVVDLKIRVNNYIERMYAAHSPAPFLSTVIHDCIEKGLDYYNGGPR
YNTNYIQCCGIGTVTDSLSAIKTHVFDAGSVSIGQLASALRANFHASEALRLKLWNKTPF
FGNDDDRADDIMRRVYDSLFAAIDGRPNTKGTGYHLNMLSTTCHVYFGKMLGASANGRLA
HLPESDGTSPSHGADRNGPTAVVKSLSKMDQIKSGGTLLNQRFLPGVLKSDQDLDKLAQL
VRTYFRLGGHHIQFNVVDTATLREAQANPAEHRNLLVRVAGYSDYFVDLDLDHQEEIIRR
TEQEMA
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgaaccagagaattgagcgcttgcgtgaagaaagtttcgccgctacgccgtccatctcc
atcgagcgcgccctgctcgaaaccgcgttctaccgcgaacactacggcaaacactccctg
cccgtgctgcgcgccctggtcttcaaagacctgtgcgaaaaaaagaccatctaccttggc
gacggcgaactcatcgtcggcgagcgcggcccccggcccaaatgcgtgccgacctttccg
gaactgacctgtcactccgcggaagacctgcgcgtgctggccacccgccccatgacgagc
taccatgtgtcggagaacgatatcgcgacctacgaacgcgaggtcatcccctactggacg
ggccgctccatgcgcgagcgcgtcttttcccggattccggacgaatggagaaccgcctat
gaggccgggctcttcaccgaattcatggagcagcgcgcgccgggccacaccgccctcgac
ggcacgatctacgaaatgggcctgctcgatttcaagcagcgcatcgccgagcgtctgacc
cgcctcgattatttaagcgaccccctggcctcggaccgggccgaacagcttcgcgccatg
gatatcgcctgcgacgcggcggtcatcttcgccaaccgtcatgccgacctggcctgggaa
ctggccaagaccgaagcggatccggcacgcaaggccgagctgacccgcatcgccgaagtc
tgtcggcacgtaccggcccatgcaccgcgcgacttctgggaagccctgcaaatgtactgg
ttcgtgcacctgggcaccatcacggagctgaacggctgggacgccatgactcccgggcac
ctcgaccagcaccttgccccgttctacgcgcaggggctggccgacggcaccctgacccgc
gaagccgccaaggaactgctctgctgcctctggatcaaggtcaacaaccatcccgccccg
cccaaggtcggggtcacggccaaggaaagcggcacctacaacgatttcaccaacatcaat
ctcgggggcctcaggcgcgacggctccgacggggtcagcgaactgtcctacctcatcctc
gaagtggtcgatgaactcaggctcctgcaaccgcagaccagcgtgcacatcagccagaag
accccggaccgcttcctgaaagccgccgcccaagtcatcagaaacggctacggctacccc
tcgatcttcaacaccgacgccgttgtcatggagcagatgcgtgtgggcaagaccgtggag
gacgcccgcgagggcggctgctccggctgcatcgaaaccggggccttcggcaaggaagcc
tacatcctgaccggctacctgaacgtgcccaaaattctggaactggccttgaacaacggc
cgcgaccaactgaccggcaaacaggtcggcccccggaccggcgagcccgaaagcttcgcc
accttcgacgacctctatgccgccttcacccgtcagctcgactgggtggtggacctcaag
atccgcgtcaacaactacatcgagcgcatgtacgccgcccactcccccgcgcccttccta
tccaccgtcatccatgactgcatcgaaaaagggctcgactactacaacggcggaccgcgc
tacaacaccaactacatccagtgctgcggcatcggcacggtcacggacagcctctcggcc
atcaagacccatgtctttgacgccggctccgtgtccataggccagctcgcaagcgccctg
cgcgccaatttccacgcctccgaagccctgcgtctgaagctctggaacaagacccccttc
ttcggcaacgacgacgaccgcgccgacgacatcatgcgccgcgtctacgactcgctcttc
gccgccatcgacggacgtcccaacaccaagggcacaggctaccacctgaatatgctctcc
accacctgccacgtctacttcggcaagatgctcggcgcctcggccaacggccgcctggcc
cacctgcccgaatccgacggcacctcgccctcccacggcgcggacagaaacggccccacc
gccgtggtcaagtccctgtccaaaatggaccagatcaagtccggcggcaccctcctcaac
cagcgcttcctgcccggagtgctcaaatccgatcaggacctggacaaactcgcgcagctg
gttcgcacctatttccgcctcggcggccaccacatccagttcaacgtcgtggacaccgcc
accctgcgcgaggcccaggccaaccccgccgaacaccgcaacctgctggtgcgcgtagcc
ggatacagcgactacttcgtcgacctggacctcgaccaccaagaagaaatcatccgccgc
actgaacaggaaatggcgtaa

DBGET integrated database retrieval system