KEGG   Desulfomicrobium baculatum: Dbac_0197Help
Entry
Dbac_0197         CDS       T00963                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dbac_0197
Enzymes [BR:dba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dbac_0197
DNA repair and recombination proteins [BR:dba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Dbac_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 HHH_2 HHH Helicase_RecD NTPase_1 AAA AAA_18 T2SSE PIF1 UvrD-helicase AAA_28 RuvB_N AAA_22 5_3_exonuc PhoH DUF2075 AAA_16 TsaE ArgK Thymidylate_kin DUF815 UvrD_C Mg_chelatase RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACU88324
UniProt: C7LTA0
Position
230286..232460
Genome map
AA seq 724 aa AA seqDB search
MCSIQGEVITVVYHNPDNGYVIARLDSPSEPGQVNVVGLLGDVAPGESLRLTGEWVEHPK
FGRQFKAESCEHLLPASINGIRRFLGSGAVKGIGEKTADRLISRFGSQILDIMDSDPEQL
LEVEGIGPAKLKTIVSSWQEKREVRGLMLFLQTHGVATTFAHRIFRHYGVNAVQRLRANP
YDLAYDIHGIGFRTADEVALKLGFAEDAPQRLEAGVEYCLRQTADGAGHMFLPRPTLAEE
AAKLLGCHDLELIEEQIDALAERKRLVIEPLPEKGVAEAVFLTYFYRTEREIASRLQGLL
DHVSRLDPQKISKAVEREEQRQSLTLSEEQRAAVESACGHKVSIITGGPGTGKTTITRVV
VRALKALGLKISLAAPTGRAAKRLAEATGFTATTLHRLLRYQPATGFEFNEEKKLSADVM
VVDEVSMLDCGLCLSLLRALPLTCRLVFVGDENQLPSVGAGNVLGDMIESGVVPAVRLTH
IYRQARESMIVVNAHRINEGEFPLGSPEAPPKADFFWVEKENLIELQALVLRMVCERIPE
AYGLDPMTDVQVLTPMHKGEVGTVALNRLLQERLNPDGRELVRGQRAYRVGDRILQLRNN
YDKEVFNGDLGRILAIDTEDETLHAEFDGREVEYGFDELDEIGLAYAISVHKSQGSEYPA
VVMPVVSQHYMLLQRNLIYTGLTRARKLAVLMGSRRAMHMGLGNERGRQRHTSLAVRLAK
EGQI
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagcatacagggcgaagtcattaccgtcgtctaccacaatcccgataacgggtac
gtcatcgcgcggctggattcgccgtccgagcccggccaggtcaacgtggtcgggctgctg
ggcgatgtggctccgggtgaatccctgcgcctgaccggcgagtgggtcgagcatcccaag
ttcggacggcagttcaaggccgagtcctgcgagcatcttctgcctgcgtccataaacggc
atccgccgctttctgggctccggcgcggtcaagggcatcggcgagaaaaccgccgaccgc
ctgatcagccgcttcggcagccagattctcgacatcatggattcggaccccgagcagctg
ctggaagtggagggcatcggcccggccaaattgaagaccatagtctcgtcctggcaggag
aagcgggaagtgcgcgggctgatgctctttttgcagacccacggcgtagccacgaccttc
gcccaccgcatcttccgtcattacggggtcaacgccgtgcagcgcctgcgggccaatccc
tatgatctggcctacgacatccatggcatcgggttccgcaccgccgacgaggtggccttg
aagctcggctttgccgaggacgcgccccagcgtctggaggccggggtggaatactgcctg
cgccagacggcggatggggcggggcacatgttcctgccgcgtcccacgctggcggaggag
gcggccaagctgctgggctgccatgacctggagctgatcgaggagcagatcgacgccctg
gccgagcgcaagcgtctggtgatcgagcccttgccggaaaagggcgtggccgaggccgtt
tttctgacctatttctaccgcaccgagcgcgagatcgcgtcgcgcctgcagggcctcctg
gatcatgtcagccgcctcgacccgcagaagatatcaaaagccgtggagcgtgaggagcag
cgccagtccctgaccctgtcggaagagcagcgcgcggcggtggagtcggcctgcgggcac
aaggtgtccatcatcaccggcgggccgggcacgggcaagacgaccatcacccgtgtcgtg
gtgcgggccttgaaagccctggggctgaagatttccctggccgcgcccacgggccgggcc
gccaaaaggctggccgaggccaccgggttcacggccacgaccctgcaccgcctgctgcgt
tatcagccggccactgggttcgagttcaacgaggagaagaaactctccgccgacgtcatg
gtcgtggacgaggtttccatgctcgactgcggtctgtgcctgtcgctcctgcgcgccctg
cccctgacctgccgcctggttttcgtcggcgatgagaatcagctgccgtcggtgggcgcg
ggcaacgtgctcggggacatgatcgaaagcggcgtggtcccggccgtgcgcctgacgcac
atctaccgccaggcgcgggagagcatgatcgtggtcaacgcccaccgcatcaacgagggc
gagtttcccctcggcagcccggaggctccgcccaaggccgatttcttttgggtcgagaaa
gagaatctcattgaactgcaggccctggtcctgcgcatggtctgcgagcgcatccccgaa
gcgtacggccttgatcccatgaccgacgtgcaggtgctcacccccatgcacaagggcgag
gtcggtaccgtggccctgaaccgcctgctgcaggaacgcctcaatccggatggccgggaa
ctggtgcgcggccagcgtgcctatcgggtcggggaccgcattctgcaactcaggaacaac
tacgacaaggaagtcttcaacggcgaccttggccgcatcctggccatcgacaccgaagac
gagaccttgcatgcggaattcgatggccgggaggtggagtacgggttcgacgaactcgac
gagatcggtctggcctacgccatcagcgtgcacaagagccagggcagcgagtatccggcc
gtggtcatgccggtggtctcgcagcactacatgctcctgcagagaaatctcatctacacc
ggattgaccagagccaggaagctggccgtgctcatgggctcgcgccgcgccatgcacatg
ggcctgggcaacgagcgcgggcggcaacgccatacgtctctggccgtgcgcctggcaaaa
gagggtcaaatctag

DBGET integrated database retrieval system