KEGG   Desulfomicrobium baculatum: Dbac_0531Help
Entry
Dbac_0531         CDS       T00963                                 

Definition
(GenBank) Diphosphate--fructose-6-phosphate1-phosphotransf erase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00010  Glycolysis / Gluconeogenesis
dba00030  Pentose phosphate pathway
dba00051  Fructose and mannose metabolism
dba00052  Galactose metabolism
dba00680  Methane metabolism
dba01100  Metabolic pathways
dba01110  Biosynthesis of secondary metabolites
dba01120  Microbial metabolism in diverse environments
dba01130  Biosynthesis of antibiotics
dba01200  Carbon metabolism
dba01230  Biosynthesis of amino acids
dba03018  RNA degradation
Module
dba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dbac_0531
   00030 Pentose phosphate pathway
    Dbac_0531
   00051 Fructose and mannose metabolism
    Dbac_0531
   00052 Galactose metabolism
    Dbac_0531
  Energy metabolism
   00680 Methane metabolism
    Dbac_0531
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dbac_0531
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dbac_0531
Protein phosphatases and associated proteins [BR:dba01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dbac_0531
Messenger RNA biogenesis [BR:dba03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dbac_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACU88655
UniProt: C7LWG3
Position
complement(607976..609289)
Genome map
AA seq 437 aa AA seqDB search
MGNAPRLDTSVTTLGPCKVDNPLPYCHHIDDAIKMPLYLSSEILDGATSNTVCEFEEAGP
RQKIYFDPPKTKCAIVTCGGLCPGINDVIRAIVMSAHHNYHISGIYGIRYGLQGFIPKYK
HDVMELTPDSVSDIHEFGGTILSSSRGPQAPEEIVDALERMNISVLFMIGGDGTMKAAST
VTKEVLRRGLKISVIGIPKTIDNDINFVTRSFGFDTAVEKATEAIRCAHIEALGAPAGIG
MVKLMGRESGFIAAQASLALKEVNFVLVPEAPFELHGPEGFLAQLKTRLEQRQHAVIVVA
EGAGQDLCHIDNQVDLSGNPILGDICDVLRSEIKKFFAATDFPYTLKYIDPSYIIRSIPA
NSNDRIYCGFLGQHAVHAAMAGKTGMVVSKLQERYLYLPLELVIAKRRKLNIFSNYWRSV
MESTGQPQAMFNCAKQA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcgccacgcctcgatacttccgtcacaacccttggcccatgcaaggtcgac
aatcccttgccctactgccaccatatcgacgacgctatcaagatgcccctctatctctcc
agcgaaatcctcgacggcgcgacgtcaaacaccgtctgtgaattcgaggaggcgggacca
aggcagaaaatctatttcgacccgcccaagaccaaatgcgccatcgtgacctgcggcggc
ctgtgtccgggcatcaacgacgtgatcagggccatcgtcatgagcgcccaccacaactac
cacatctccggaatctacggcatccgctacggcctgcagggcttcatccccaaatacaag
cacgatgtcatggaactgaccccggacagcgtcagcgacatccatgaattcggcggcacg
atcctgtcctcctcgcgcgggccgcaagccccggaggagatcgtggacgcgctggagcgc
atgaacatctcggtcctgttcatgatcggcggcgacggcaccatgaaggccgccagtacg
gtaaccaaggaggtgctgcgacgcgggctgaagatctcggtcatcggcatccccaagacc
atcgacaacgacatcaacttcgtgacccgctcgttcggcttcgacacggccgtcgaaaag
gccaccgaggccatccgctgcgcccacatcgaggctttgggggcgcccgccggcatcggc
atggtcaagctcatgggccgcgagtcgggcttcatcgcggcccaggcaagcctggccttg
aaagaggtcaatttcgtgctggtccccgaagcgccttttgaactgcacggcccggaagga
tttctggcccagctcaagacccgcctggagcagcgccagcacgcggtcatcgtcgtggcc
gagggagctgggcaggacctgtgccacatcgacaatcaggtcgatctttcgggcaatccc
atcctgggcgacatctgcgacgtgctgcgttcggagatcaagaaattcttcgcggccacg
gattttccctacaccctcaaatacatcgaccccagctacatcatccgctccatcccggcc
aactccaacgaccgcatctactgcggcttcctgggccagcacgccgtgcacgcggccatg
gccggcaagaccgggatggtcgtctccaagctgcaggagcgctacctctacctgcccctg
gaactggtcatcgccaagcgccgcaagctcaatatcttctccaactactggagatcagtc
atggaatccaccggacaaccccaagccatgtttaactgcgccaaacaggcatag

DBGET integrated database retrieval system