KEGG   Desulfomicrobium baculatum: Dbac_0662Help
Entry
Dbac_0662         CDS       T00963                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00260  Glycine, serine and threonine metabolism
dba00630  Glyoxylate and dicarboxylate metabolism
dba00670  One carbon pool by folate
dba01100  Metabolic pathways
dba01110  Biosynthesis of secondary metabolites
dba01130  Biosynthesis of antibiotics
dba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dbac_0662
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dbac_0662
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dbac_0662
Enzymes [BR:dba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Dbac_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: ACU88785
UniProt: C7LN15
Position
complement(737293..738375)
Genome map
AA seq 360 aa AA seqDB search
MSELLTTPLHAWHKNNGARMVPFAGWDMPVQYVGILEEHKHTRSQASIFDISHMGEFLLE
GHGATEALASVVTHNLATLAPGKCRYGFLLNEKGGVLDDLIVYRLDTEKYMLVVNGACID
SDFAWIKSHLPANLTLVNQSFDIAKIDLQGPESFDVLARIMPADWNSLGYFGFREVEFEG
FKVIVSRTGYTGELGCEFYLPWGKAEVLWEKLMADEAVRPAGLGARDTLRLEVGLPLYGQ
DLDMDHTPVEAGYGGMLKSEADYIGKSGLGSVREKLIGLCIDGRRSARHYDEVYAGEEKV
GMVTSGSIAPSLGYCVAMAFVRADMADTESFTIKGPRTTLEAVRVDMPFYTAGTARRKLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaattgctgaccacccctcttcatgcctggcacaagaacaacggggccagaatg
gtccctttcgcgggctgggacatgcctgtccaatatgtcggcatccttgaagagcacaaa
cacaccagaagtcaggcgtccatcttcgacatctcccacatgggagagttcctgctcgaa
gggcacggcgcgaccgaagccctggcctctgtcgtgacccacaacctggccacgcttgct
ccggggaagtgccgctacggcttcctcctgaacgaaaagggcggcgtgctcgacgacctc
atcgtctaccggctggacacggaaaaatacatgctcgtggtcaatggcgcatgcatcgat
tccgatttcgcctggatcaaaagtcacctcccggcaaacctgaccctggtcaaccagagc
ttcgacatcgccaagatcgacctgcagggaccggaatcatttgacgtgctggcccgcatc
atgcccgcggactggaacagccttggctatttcggattccgtgaagtggaattcgaagga
ttcaaggtcattgtcagccgcacgggctacacgggcgaactgggctgcgaattctacctg
ccctggggcaaggccgaggtgctgtgggagaagctgatggccgatgaagctgtccgcccg
gcaggccttggcgcgcgcgacaccctgcgccttgaggtggggctgcccctctacggccag
gacctggacatggaccacaccccggtggaggcaggctacggaggcatgctcaagagcgag
gccgattacatcggcaaatcaggccttggcagcgtgcgcgagaagctgatcggcctgtgt
atcgacggccgccgcagcgcccgccattacgacgaggtttatgccggcgaggagaaggtc
ggcatggtcaccagcggctccatcgcgcccagcctcggctattgcgtggccatggccttt
gtgcgcgcggacatggccgacacggagtcgtttacgatcaaggggccccggaccaccctt
gaagccgtccgcgtggacatgcccttctacaccgcgggcacggcccgcaggaagctggcc
tag

DBGET integrated database retrieval system