KEGG   Desulfomicrobium baculatum: Dbac_1111Help
Entry
Dbac_1111         CDS       T00963                                 

Definition
(GenBank) aminoglycoside phosphotransferase
  KO
K02204  homoserine kinase type II [EC:2.7.1.39]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00260  Glycine, serine and threonine metabolism
dba01100  Metabolic pathways
dba01110  Biosynthesis of secondary metabolites
dba01120  Microbial metabolism in diverse environments
dba01230  Biosynthesis of amino acids
Module
dba_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dbac_1111
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     Dbac_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase
Motif
Other DBs
NCBI-ProteinID: ACU89215
UniProt: C7LQY6
Position
complement(1222008..1222973)
Genome map
AA seq 321 aa AA seqDB search
MVNPPSPKPALHPSNELLRDILNCWGLTFEAIHPRISIQGSPERCLYRVVVDAGGSRHFL
EELDSRTLPRKRLIAARIAHLEAKALPVAAPQTGLDGSFTQRVGSRNWQLTPFLEGIELN
PEGSWRDAWRGKALALFLRDLRQASQNMAVHEDVFDLHGYVRKIVNDARRLHPNVCAELT
PVFSLIERKLESCASLPVAFCHGDPHPLNMIWGTDRILGAIDWEFCGPKCVLHDMALILG
CVGSEDENALSGPFITAFLKTLRGCGLLDSRLETHLPTWTLALRVAWLAEWLRRGDTEMT
QFEVFYMRTLENRFFGRDKAF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaccccccttcccctaagcccgccctgcatccatctaacgaactactgcgcgac
attttgaactgctggggcctgactttcgaagccattcatccccgcatttccatccagggc
agccccgagcgctgcctgtacagagtggtagtggacgccggcggctcgcgccatttcctg
gaagaactcgattcccgaaccttgccacgcaaaaggctgatcgccgctcgcatcgctcat
ctggaagccaaggcattgcccgtggctgcgcctcagaccggacttgacgggagtttcacg
caacgtgtcggcagccggaactggcagctgacgccttttctggaggggattgaactcaac
ccagagggctcatggcgggatgcatggcgcggcaaggccctggctctgtttctgcgtgat
ctgcggcaggcgagccagaatatggccgtgcatgaagacgtctttgacctgcacggctat
gtccgaaaaatcgtgaatgacgccagaaggctgcatccgaacgtctgcgcggagcttacc
cccgtcttttctctcatcgagcgaaagcttgagtcctgcgccagtctgcctgtggctttc
tgtcacggcgatccccaccctctgaacatgatctggggcacggaccgcatcctgggcgcc
atcgactgggaattctgcggacccaaatgcgtcctgcacgacatggccctgatcctgggc
tgcgtaggcagcgaagacgaaaacgccctgagcggccccttcatcactgcctttctgaag
accctgcgcggctgcggcctgctggacagcaggctggaaacgcacctgccgacctggact
ctggccctgcgcgtggcctggttggcggaatggttgcggcgaggcgatacagagatgacc
cagttcgaggtcttctatatgaggaccctggaaaatcggttcttcgggcgagacaaggcg
ttctga

DBGET integrated database retrieval system