KEGG   Desulfomicrobium baculatum: Dbac_1866Help
Entry
Dbac_1866         CDS       T00963                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00010  Glycolysis / Gluconeogenesis
dba00030  Pentose phosphate pathway
dba00051  Fructose and mannose metabolism
dba00680  Methane metabolism
dba01100  Metabolic pathways
dba01110  Biosynthesis of secondary metabolites
dba01120  Microbial metabolism in diverse environments
dba01130  Biosynthesis of antibiotics
dba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dbac_1866
   00030 Pentose phosphate pathway
    Dbac_1866
   00051 Fructose and mannose metabolism
    Dbac_1866
  09102 Energy metabolism
   00680 Methane metabolism
    Dbac_1866
Enzymes [BR:dba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Dbac_1866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX DUF2399
Motif
Other DBs
NCBI-ProteinID: ACU89957
UniProt: C7LWS4
Position
2126066..2127046
Genome map
AA seq 326 aa AA seqDB search
MEAPQRNLAMDLVRVTEAAALASARWLGKGAKNEGDGAAVDAMRLSFNTLDIDGRIVIGE
GEKDEAPMLYNGERIGTGRGAAVDVAVDPVEGTNLLAYGRPNAIAVVGLAPAGTMFNPGP
SYYMKKLVVPAAAKGMVDMNAPVAHNLEVTAKALGKKVEDLVVFVLDKPRHKDLITQIRA
AGARIQLHTDGDVAGALMAVDPSSNVDMMFGTGGTPEGVLAACAIKALGGEILAQFDPQS
EDERKNVLDFGLDLTQILTTDTLVCDDNVFFAATGISGGTFLGGVSYSGTGATTHSLVLR
GKTGTIRRITSTHQWDKLMRFSSIKY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaagccccgcaacgaaatctggccatggacctggtccgggtcacggaagccgcggcc
ctggcctcggcccgctggttgggcaagggcgccaagaatgagggcgacggagcggccgtg
gacgccatgcgcctgtccttcaacacccttgatatcgacggtcgcatcgtcatcggcgaa
ggcgagaaggacgaagcccccatgctctacaacggcgagcgcatcggcacgggccggggc
gcggccgtggacgtggctgtggacccggtggagggcaccaacctcttggcctatggacgc
cccaacgccatcgccgtggtcggcctggctccggccgggaccatgttcaatccgggcccg
agctattacatgaagaaactcgtggtcccggcagcggccaagggcatggtggacatgaac
gcgcccgtggcccacaaccttgaggtcacggccaaggccctgggcaagaaggtcgaggat
ctggtggtttttgttctcgacaagccccgccacaaggacctcatcacccagatccgcgcc
gcaggggcacgcatccagttgcacaccgacggcgacgtggccggggcgctcatggccgtg
gacccgtcatccaatgtggacatgatgttcggcaccggcggcactcccgaaggggtactg
gcggcctgcgccatcaaagccctgggcggggagatcctggcccagttcgacccccagtcc
gaggacgaacgcaagaacgtgctcgacttcggcctggacctgacgcagatcctgaccacg
gacacccttgtttgcgacgacaacgtcttcttcgcggccacgggcatctccggcggaacg
ttcctgggcggcgtgtcgtacagcggcaccggcgcgaccacccactccctggtcctgcgc
ggcaagaccggcaccatccgccgcatcacctccacccaccagtgggacaagctgatgcgc
ttttcttcaatcaagtactag

DBGET integrated database retrieval system