KEGG   Desulfomicrobium baculatum: Dbac_2068Help
Entry
Dbac_2068         CDS       T00963                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00620  Pyruvate metabolism
dba00630  Glyoxylate and dicarboxylate metabolism
dba01100  Metabolic pathways
dba01110  Biosynthesis of secondary metabolites
dba01120  Microbial metabolism in diverse environments
dba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dbac_2068
   00630 Glyoxylate and dicarboxylate metabolism
    Dbac_2068
Enzymes [BR:dba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dbac_2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Nitr_red_bet_C
Motif
Other DBs
NCBI-ProteinID: ACU90153
UniProt: C7LNS9
Position
2372527..2374680
Genome map
AA seq 717 aa AA seqDB search
MTYIPVGGLNVAKPLHDLIRDKATPGTGVTDTDFWAAFEKILHDLSPRNRELLAKRQYLQ
ETIDSWHKRHKDGPHDAVAYEQLLREIGYIVPEGLPFSIGTSGVDPEISSIAGPQLVVPA
TNARYALNAANARWGSLYDALYGTDVLSEEGGATREGAYNPVRGTKVMEFAARFLDKALP
LARGSHGDVQEYRLVPTGKGATMEIHLQDGLTALQNPEAFAGFAPDVLLFKNNGLHIELH
FDRNHPVGKAHPAGVKDVVLEAAMTTIVDFEDSIAAVDGEDKAQTYANWLGLLRGDLLAS
FPKGGKTVSRSLSPDRAYTAPDGSPLTLPGRSLLLVRNVGHLMTTNAVLLGSDEVQEGIL
DAMVTGLIALHDLKELGSLRNSRSGSVYIVKPKMHGPEEVAFACDLFDRVEDALGMPRHT
MKIGIMDEERRTSVNLAECIRAAKDRVIFINTGFLDRTGDEIHTSMEAGPMVPKAAMKNA
RWILSYEDWNVDTGLACGFSGKAQIGKGMWAMPDRMKQMVETKQAHPLAGANCAWVPSPT
AATLHAMHYHEVDVFARQAELQRTKRASLNELLTLPLLDHPLSTEEIQRELDNNCQGILG
YVVRWIDQGIGCSKVPDITDVGLMEDRATLRISSQYIANWLHHGLCSLEQVRATLERMAA
VVDRQNQGDPAYRPMAPDFDASIAFEAASDLIFKGREQPSGYTEPILHARRRERKAK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacttatatccctgtcggcggattgaacgtcgcaaagccccttcatgatctgatacgc
gataaagccacgcccggaaccggcgtgacggacacggatttttgggccgcctttgaaaaa
attctgcacgacctgtccccgcgcaaccgcgaactgctggccaagcgccagtatctgcag
gaaaccatcgattcgtggcacaagcggcacaaagacggaccacatgacgccgtcgcctac
gagcagctcctgcgcgagatcggctacatcgtgccggagggcctgcccttctccatcggg
accagcggcgtggacccggaaatatcatccatcgccgggccacaactcgtcgtcccggcc
accaacgcccgctacgccttgaacgcggccaatgcccgctggggcagcctgtacgacgcc
ctgtacggaacggacgtgctctccgaagaaggcggcgcgacacgggagggagcgtacaac
cctgtgcgcgggaccaaggtcatggaattcgcggcccgtttcctggacaaagccctgccc
ctggcccgaggcagccacggtgatgtccaggagtaccggttggtgcccacaggcaaaggc
gccacgatggagattcatttgcaggacggcctgaccgcgctgcaaaacccggaggctttc
gccggattcgcgcccgatgtcctgcttttcaaaaacaacggactgcacatcgaactgcat
ttcgaccgcaatcatcccgtgggcaaggcccatcccgcaggcgtcaaggacgtggtgctg
gaagcggccatgaccactatcgtcgacttcgaggactccatcgccgccgttgacggcgag
gacaaggcccagacgtatgccaactggctgggcctgctgcgcggcgacttgttggcgtcc
tttcccaagggcggcaaaaccgtcagtcgcagcctcagtcccgaccgcgcctacaccgct
cccgacggctcgcccctgaccctgcccggacgcagcctgctgttggtgcgcaacgttggc
catctcatgaccacgaacgcggtcctgctcggctccgacgaagtccaggaaggcatcctt
gacgccatggtcaccggccttatcgccctgcacgacctcaaggagctcggatccctgcgc
aacagccgctccggcagcgtgtatatcgtcaaacccaagatgcatggccccgaagaagtc
gccttcgcctgcgacctgtttgaccgcgtggaagacgcgctgggcatgccccgccacacc
atgaaaatcggaatcatggacgaggagcgcaggacatcggtcaatctggcggaatgcatc
cgcgcggccaaggaccgggtcatcttcatcaacacgggttttctggatcgcaccggcgat
gaaatccacaccagcatggaagccggtcccatggtgcccaaggcggccatgaagaacgcc
cgctggattctgtcctacgaggattggaacgttgacacgggcctggcctgcgggttttcc
ggcaaggcccagatcggcaagggcatgtgggccatgccggaccgtatgaaacagatggtc
gaaaccaagcaggcgcatcccctggccggagccaactgcgcctgggttccgtcccccacg
gccgcgaccctgcacgccatgcactaccatgaagtggatgtctttgcccgtcaggcggaa
ctgcagcgcaccaagagggccagcctgaacgagcttctgaccctgcccctgcttgaccat
cccttgtccacggaggagatccagcgtgaactggacaacaactgccagggcatcctgggc
tacgtggtacgctggatcgaccagggcatcggctgctccaaggtgccggacataaccgac
gtggggctcatggaagaccgcgccaccctgcgcatctccagccaatacatcgccaactgg
ctgcaccatggcctgtgcagcctggaacaggtccgcgccaccctggaacgcatggccgcc
gtggtcgacaggcagaaccaaggcgacccggcctaccgccccatggcccccgacttcgat
gccagcatagcctttgaggccgccagcgacctgatcttcaaaggccgcgagcagccgagc
gggtatacggaacccatcctgcacgccagaagaagggaacgcaaagccaaataa

DBGET integrated database retrieval system