KEGG   Desulfomicrobium baculatum: Dbac_2150Help
Entry
Dbac_2150         CDS       T00963                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00030  Pentose phosphate pathway
dba01100  Metabolic pathways
dba01120  Microbial metabolism in diverse environments
dba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dbac_2150
Enzymes [BR:dba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Dbac_2150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACU90234
UniProt: C7LPK5
Position
2462645..2464504
Genome map
AA seq 619 aa AA seqDB search
MPYGYNGKILVVDLTAGTWSVDEHDETWYRTYWGGGALASWYMHKFIPTKTDPLGPENVL
IFAASVLCGCGMSGFNRYTVAAMSPLTGGFGESEAAGYFGPEMKHAGFDAVVFKGKSSKP
VYLWINKGQVELRPAGQLWGMENAPFLDAVREELGDKKIRIASIGPAGEKMSRLACIINE
LAHANGRSGMGAVMGSKNLKAVIVRGEEGGIELANPEAFKELNLFHRKRIGEHMPNVGMR
KFGTVQHMMAQQNSGILPTRNWKDCQFEDAAKLGWEGYEKVFDGNHTCYKCTVACKRKVN
NIAEKRYGGPEYETLAALGSMCGVGDLDAVCRGHELCNAMGLDTVGAGAAVAFAMELAQK
GILDAKDMGGRLITFGDGAGMLELLGKIARREGLGDILADGVKRAAERIGKGSEEYAFHV
KGQEPAFHDPRGKTGVGLGFALSPTGADHIEAPHEVPFQGEGVKLVNPLGIIVAPKALDN
GLGKVRYFIAGEKTWAMNNTLGICNFVVAPLFALSYAKLCEVVEAVTGWSTSLHELMLVA
ERSMVLARMFNIREGMDSKDDTLFRRMFEPLPEGPLKGTTIDPTEFKNMLGMYYAMMNWT
EKGIPREGALYNLSLDWLN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatggttataacggaaaaatcctggtggttgacctgactgcgggcacgtggtcc
gtggatgaacacgatgaaacatggtaccgcacctactggggcggcggtgccctggccagc
tggtacatgcacaaattcatcccgacgaagaccgatcccctcggtccggaaaacgttctc
attttcgcggcctcggtgctctgcggctgcggcatgtcgggtttcaaccgctacacggtg
gcggccatgagtcccctgacagggggctttggcgaatccgaagcggccggatatttcggc
ccggagatgaagcacgccggctttgacgccgttgtcttcaagggcaaatcgtccaaaccc
gtttatctgtggatcaacaaggggcaggtcgaactgcgccccgccggtcagctttggggc
atggaaaacgcgccgttcctggacgccgtccgcgaggaactgggcgacaagaagatccgc
atcgcctccatcgggcccgccggcgagaagatgagccgcctggcctgcatcatcaacgaa
ctggcccacgccaacggccgcagcggcatgggcgcggtcatgggctccaagaatttgaaa
gccgtcatcgtgcgcggagaggaaggcggcatcgaactcgccaaccccgaggccttcaag
gaactcaatctgttccaccgcaagcgcatcggcgaacacatgccaaacgtcggcatgcgc
aagttcggcacggtccagcacatgatggcccagcagaactccggcatcctgccgacccgc
aactggaaggactgccagttcgaagacgcggccaagctcggctgggaaggctacgaaaaa
gtcttcgacggcaaccacacctgttacaaatgcaccgtggcctgcaagcgcaaggtcaac
aacatcgccgaaaagcgctacggcggacccgagtacgaaaccctggccgcccttggttcc
atgtgcggcgtgggcgatctggacgcggtttgccggggtcacgagctctgcaacgccatg
ggccttgataccgtaggggccggagccgccgtggcctttgccatggaactggcccaaaag
ggcatcctcgacgccaaggacatgggcggacggctgatcaccttcggtgacggcgcgggc
atgctcgaactgctgggcaaaatcgctcgccgtgaaggacttggcgacatcctcgccgat
ggtgtcaaacgtgcggccgagcgcatcggcaagggctccgaggaatacgcattccacgtc
aagggacaggaaccggcctttcatgatccgcgcggcaagaccggcgtgggccttggtttt
gccctgtcccccacgggcgcggaccatatcgaggccccgcatgaggtccccttccagggt
gaaggcgtgaaactcgtcaacccgctcggcatcatcgtggcccccaaggctctggacaac
ggcctgggcaaagtgcgctacttcatcgcgggtgaaaagacctgggccatgaacaacacg
ctcggcatctgcaatttcgtggtcgcgcccctcttcgcgctgagttacgccaagctgtgc
gaagtcgtcgaagcggtgacgggctggtcaaccagcctgcacgaactcatgctcgtcgcg
gagcgctccatggtcctcgcacgcatgttcaacatacgggaaggcatggacagcaaggac
gacacactgttccgccgcatgttcgagcctctgccggaaggccccctcaaaggcacgacc
attgatccgacggaattcaagaacatgctgggcatgtattatgccatgatgaactggact
gaaaaaggcatcccgcgtgaaggggctctctacaacctgagcctcgattggctgaattag

DBGET integrated database retrieval system