KEGG   Desulfomicrobium baculatum: Dbac_2902Help
Entry
Dbac_2902         CDS       T00963                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00230  Purine metabolism
dba01100  Metabolic pathways
Module
dba_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dbac_2902
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dbac_2902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_33 MMR_HSR1 AAA_16 RsgA_GTPase AAA MobB AAA_18 ABC_tran AAA_30 AAA_29 RNA_helicase Rad17
Motif
Other DBs
NCBI-ProteinID: ACU90977
UniProt: C7LUR2
Position
3283656..3284303
Genome map
AA seq 215 aa AA seqDB search
MNSASMHPSDTNVGMMLVISAPSGTGKSTLIRRLTTEFNAFTFSVSCTTRAPRPGEVDGR
EYHFLTREEFLRRREEKYFAEWAEVHGNLYGTPRQTTMDLLALGRDVIFDIDVQGARQIK
SNMGQGCYVFVFPPSRDALEKRLTGRGTDSEETIIRRLAAARHEIADSQWFDHWVINDEL
DSAYQELRAIYLAEKTRPAYRASWQAALSRQWGVS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcgcaagcatgcatccctctgacaccaacgtgggcatgatgctcgtcatcagc
gccccttcgggcacaggaaaaagcaccctcatccggcgtctgaccacggaattcaacgcc
ttcaccttttccgtgtcctgcaccacccgcgccccgcgcccaggcgaggtcgacggccgg
gaatatcatttcctgacccgcgaggaatttctgcgccgccgggaagagaagtatttcgcc
gaatgggccgaagtccacggcaatctctacggcactccgcgacagaccaccatggatctg
ctggcccttgggcgcgacgtcatcttcgacatcgacgtgcagggcgcgcgccagatcaaa
agcaacatgggtcagggctgttacgtgttcgtctttcctccctcgcgcgatgccctggaa
aagcgcctgaccggacggggcacggacagcgaagaaaccatcatccgccgtctggccgct
gcccgacacgaaatcgcggacagccagtggtttgaccactgggtcataaatgacgaactg
gattcggcctaccaagaactgcgcgccatctatctggctgaaaaaaccaggcctgcatac
agggcgtcatggcaagccgccctcagccgccaatggggggtgtcatga

DBGET integrated database retrieval system