KEGG   Desulfomicrobium baculatum: Dbac_3166Help
Entry
Dbac_3166         CDS       T00963                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00010  Glycolysis / Gluconeogenesis
dba00620  Pyruvate metabolism
dba00640  Propanoate metabolism
dba00680  Methane metabolism
dba01100  Metabolic pathways
dba01110  Biosynthesis of secondary metabolites
dba01120  Microbial metabolism in diverse environments
dba01130  Biosynthesis of antibiotics
dba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dbac_3166
   00620 Pyruvate metabolism
    Dbac_3166
   00640 Propanoate metabolism
    Dbac_3166
  Energy metabolism
   00680 Methane metabolism
    Dbac_3166
Enzymes [BR:dba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dbac_3166
Lipid biosynthesis proteins [BR:dba01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dbac_3166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACU91241
UniProt: C7LXK5
Position
complement(3581223..3583169)
Genome map
AA seq 648 aa AA seqDB search
MKRGLPRKENAMKETDMAYSEELVFRPLPQLVIEANVNPQEFATAQASAKADFLGYWEDA
AQELDWFHKWDTVLDDSEAPRYHWFKGAQCNIVYNALDRHIETANKNKLALIWEGEAGDT
KKYTYYELYREVNKLANAMRSLGLGKGDRVVLYMPLIPQTMMAMLACAKIGAVHCAVFAG
FSAKALRQRITEVEAKLVVTADGFYRNGRIVNLKATVDEALVGGCDCVETVVVVNRAKLD
VDMGEARDIWYDALVRQERSDAATEIMNSDDPLFILHTSGTTGEPKGIVHGHAGYMVGLH
RSLDWVFDIKPTDIFWCTGDMGWITGHSYVVYGPLIAGTTTVMYEGHPLYPQADRMWDIV
ARYGVTVLYTAPTVIRMLMRYGNQYPRMHDLSTLRLLASVGEPISPDTWLWFYKYIGHSQ
CPILDTWWQTETGGCMITPFPVSVLKPGSVHRPMPGIEVDIVDEEGNRVEDGVAGNLVVT
KPWPSMLLDIFGKPEMHEATYWPLGPGKYWAGDIATRDEDGLIWIHGRSDDVMNIAGHRI
GNVELENAFLAHKAVADAAVIGIPDKIKGEVAKAFIVLQPEFAALDDHNEIIRMLKTHIR
KEVGPVAVIRSVEFVEALPRTRSGKIVRRVLKAREAGLEVDLGAVVED
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcggcctgccgcgcaaggagaacgccatgaaagaaaccgacatggcctatagc
gaggaactcgtcttccgtcccctgccccaactggtcatcgaggccaatgtcaacccgcag
gaattcgccacggcccaggcctcggccaaggccgactttcttggctactgggaagacgcg
gcccaggagctggactggttccacaaatgggacacggtgctggatgactccgaagcgccg
cgctaccactggttcaagggagcccagtgcaacatcgtctacaacgccctggaccggcac
atcgagaccgccaacaagaacaagctggcgctgatctgggaaggcgaggccggagacacc
aagaagtacacctactacgagctctaccgtgaggtgaacaagctggccaatgccatgcgt
tccctgggacttggcaagggcgaccgggtggttctctacatgccgctcatcccccagacc
atgatggccatgctggcctgcgccaagatcggggccgtgcattgcgcggtctttgccggg
ttctcggccaaggccctgcgccagcgcatcaccgaggtcgaggccaagctggtggtcacg
gccgacggattctatcgaaacggccgcatcgtcaacctgaaagccaccgtcgacgaggcg
ctggtgggagggtgcgactgcgtggagaccgtggtcgtggtcaatcgcgccaagctggac
gtggacatgggcgaggcccgcgacatctggtacgatgccctggtgcgccaggaacgctcg
gatgcggcaaccgagatcatgaattccgatgatccgcttttcatcctgcacacctcggga
accacgggcgaacccaagggcatcgtgcatggccatgccgggtacatggtggggttgcac
cggtcgctggactgggtcttcgacatcaagcccacggacattttctggtgcaccggcgac
atgggttggatcaccggccacagctacgtggtctacggcccgctcatcgccggcacgacc
acggtcatgtacgaggggcaccccctctatccccaggccgaccgcatgtgggacatcgtg
gcccgctacggggtgacggtcctctacaccgcgcccacggtcatccgcatgctcatgcgc
tacggcaaccagtatccgcgcatgcacgacctctccaccctgcgcctgctggccagcgtc
ggcgaacccatctcgccggacacttggctgtggttctacaagtatatcgggcactcccag
tgccccatcctcgatacgtggtggcaaacagaaacgggcgggtgcatgatcacgcccttc
ccggtctcggttttgaaacccggctccgtgcaccggcccatgccgggcatcgaggtggac
attgtcgacgaggagggcaaccgcgtggaggacggagtcgccggcaacctggtggtgacc
aagccctggccgtccatgctgctcgatattttcggcaagccggagatgcacgaggcgacc
tactggcccctgggtcccggcaagtactgggcaggggacatcgccacccgcgacgaggac
ggcctgatctggattcatggccgctccgacgacgtcatgaacatcgccgggcaccgcatc
ggcaacgtcgaactggaaaacgccttcctcgcccacaaggccgtggccgacgccgccgtc
atcggcatcccggacaagatcaagggcgaagtggccaaggccttcatcgtgctgcaaccg
gaattcgcagccctggacgaccacaacgaaatcatccgcatgctcaaaacccatatccgc
aaggaagtgggccccgtggccgtgatccgctccgtggagttcgtggaggccctgccccgc
acccgcagcggcaagatcgtgcgccgggtattgaaggccagggaagcggggctcgaggtc
gacctaggtgccgtcgtcgaagactag

DBGET integrated database retrieval system