KEGG   Desulfarculus baarsii: Deba_0235Help
Entry
Deba_0235         CDS       T01284                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00450  Selenocompound metabolism
dbr00970  Aminoacyl-tRNA biosynthesis
dbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Deba_0235
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Deba_0235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dbr01007]
    Deba_0235
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dbr03016]
    Deba_0235
Enzymes [BR:dbr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Deba_0235
Amino acid related enzymes [BR:dbr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Deba_0235
Transfer RNA biogenesis [BR:dbr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Deba_0235
 Prokaryotic type
   Other AARSs
    Deba_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADK83612
UniProt: E1QGA0
Position
258857..260827
Genome map
AA seq 656 aa AA seqDB search
MEATFYITTPIYYVNAEPHLGHAYTTIVADVARRFHLLLGQTARMQTGTDEHGDKIAEAA
AKNGLSPRQYADRVSGLFRDLWPHLHIQYDRFVRTTDPQHIQTVRALLQKVHDQGDIYFA
KYGGNYCVACERFLTDKELVEGKCPDHHTEPVYIEEENYFFRMGKYQQALIEHIQANPDF
IRPERYKNEVLSMLAEPLDDLCISRPKSRLTWGVELPFDQNFVTYVWFDALINYITGLDY
PNGDDFARFWPGQHLIAKDILKPHAIFWPTMLMAMGLPLYQRLNVHGYWNVDQAKMSKSL
GNVVRPLELAQVYGVDAFRYFLLREMAFGLDAGFSEELLIQRYNADLANDLGNLYSRVLN
MLVKYHNGVVPQPGPLTPADEELAQVAAQARDGLRQGFEAFAFHKGLARLWELIGAANKY
VVANEPWALAAQPEQAPRLARVMHELVRTLAQVAVLIWPVMPEMAETMAGHMGLAHPARI
GLAGLESDALTPAGTVIAKPATLFPRIDTAGVQAKAHKAEVKAQAKQADAPPAKAPRAAK
AEAGPAQQPIGIEDFGRVELRVGLIVEAAPVEGADKLLRLSVDLGEDAPRTIVAGIAKHY
QPAALPGRRVVVVANLKPAKLRGVLSHGMCLAAVSPDGGLSLVDPGPEATPGSIVR
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgacattttatataaccacgcctatttattacgtaaacgccgaaccgcatctg
ggccacgcctacaccaccatcgtcgccgacgtggccaggcgctttcatctgctactgggc
cagaccgcccgcatgcagaccggcaccgacgagcacggagacaagatcgccgaggccgcc
gccaaaaacggcctctcgccccggcaatacgccgaccgcgtcagcggcctgttccgcgac
ctttggccccacctgcacatccaatacgaccgcttcgtgcgcaccaccgatccccagcac
atccagaccgtgcgcgccctgctgcaaaaggtccacgaccagggcgacatctatttcgcc
aaatatggcggcaactactgcgtggcctgcgagcgcttcctcaccgacaaggagctggtc
gagggcaaatgccccgaccatcacaccgagccggtctacatcgaggaagaaaactatttc
tttcgcatgggcaagtatcaacaggccctcatcgagcacatccaggccaaccccgacttc
atccggcccgaacgctataaaaacgaagtgctaagcatgctggccgagcccctggacgac
ctgtgcatcagccggcccaaaagccgcctgacctggggcgtcgagctgcctttcgatcaa
aacttcgtcacatatgtctggttcgacgccctgatcaactacataaccggcctggattat
cccaacggcgacgattttgcgcgcttctggcccggccagcacctcatcgccaaggacatc
ctcaagccccacgccatcttctggccgaccatgctcatggccatgggcctgcccctctac
cagcgcctcaacgtgcatggctattggaacgtggaccaggccaagatgagcaagtccctg
ggcaacgtggtgcggcccctggagctggcccaggtctacggcgttgacgccttccgctat
tttttgctgcgcgagatggctttcggcctggacgccggcttcagcgaagagcttttgatc
cagcgctacaacgccgatttggccaacgacctgggcaatttgtacagccgtgtgttgaat
atgctcgtaaaatatcacaacggcgttgtgccccaacctgggccgctcaccccggccgac
gaggagctggcccaggtcgccgcccaggctcgggacggcctgcgccagggcttcgaggcc
ttcgccttccacaagggcctggcccgcctgtgggagctgatcggcgcggccaacaagtac
gtggtggccaacgagccctgggccctggccgcccagcccgagcaggccccgcgcctggcc
cgggtcatgcacgagcttgtgcggaccctggcccaggtggcggtgctgatctggccggtg
atgcccgaaatggccgagaccatggccgggcacatgggcctggcccaccccgcgcgaatc
ggcctggccgggctggaaagcgacgcgctcacgccggcggggacggttatcgccaagccg
gccacgctgttcccacgcatcgacaccgccggcgtccaggccaaggcccacaaggccgaa
gtcaaggcccaggccaaacaggccgacgcgccgccggccaaggccccgcgggccgccaag
gccgaggccggcccggcccagcagcccatcggcatcgaagacttcggccgggtggagctg
cgcgtgggcctgattgtcgaggccgcgccggtggaaggggccgacaagctactgcgcctg
agcgtggacctgggcgaggacgcgccgcgcaccatcgtcgccggcatcgccaagcactat
cagccggccgcactgcctggccgccgagtggtggtggtggccaacctcaagccggccaag
ctgcgcggcgtgctcagccacggcatgtgcctggccgccgtgagccctgatggcggcctg
agcctggtggaccccggccccgaggccacgccgggcagcatcgtgcgctga

DBGET integrated database retrieval system