KEGG   Desulfarculus baarsii: Deba_0329Help
Entry
Deba_0329         CDS       T01284                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00860  Porphyrin and chlorophyll metabolism
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
dbr01120  Microbial metabolism in diverse environments
Module
dbr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dbr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deba_0329
Enzymes [BR:dbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Deba_0329
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Deba_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M CysG_dimeriser DUF2375 MOR2-PAG1_mid
Motif
Other DBs
NCBI-ProteinID: ADK83705
UniProt: E1QDR9
Position
373222..373920
Genome map
AA seq 232 aa AA seqDB search
MVLSYYPVLLDVRGREVLVIGGGPVAARKVGGLLAAGAVVRLVAPELCAAAVELALGPGV
GYHARGFEASDLDGVVLVFCASGDSAVNARAAELARSRGIFVNVVDAPEAGDMIVPAHFR
RGELLVAVATGGASPALSRRLRQRLEVEFGPEWGPLLRLLAAARRAVLAGGGDGADHRRV
FYELVDSRLAEFLRAGDWAGVDGLLREALGLGLADLGLGPDDLQPRPEDGRP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgagctattatccggtattgttggatgtgcgggggcgggaggtgttggtgatt
ggcggtggtccggtggcggcgcgcaaggttggtggtttgttggcggcgggggcggtggtg
cggctggttgcgccggagctgtgcgcggcggcggtggagttggcgctggggcctggggtg
ggatatcatgctcgtgggtttgaggcgagcgatctggacggtgtggtgttggttttttgt
gcgtctggcgatagcgcggtgaatgcgcgggcggcggagttggcgcggtcgcgggggata
ttcgtgaacgtggttgacgcgccggaggctggcgacatgattgtgccggcgcattttcgg
cgtggcgaattgttggtggcggtggccacgggcggggcttcgccggcgttgtcgcggcgg
ttgcggcagcgtttggaggttgagtttggcccggagtggggtccgttgttgcgacttttg
gcggcggcgcgtcgggcggtgttggctggcggcggcgatggggccgatcatcgccgggtg
ttttacgagctggtggattcgcggctggcggagtttttgcgggctggcgactgggccggg
gtggacgggcttttgcgggaggcgttgggcctggggctggcggatttgggccttgggccg
gatgatttgcaaccgcgaccggaggatgggcggccatga

DBGET integrated database retrieval system