KEGG   Desulfarculus baarsii: Deba_0969Help
Entry
Deba_0969         CDS       T01284                                 

Definition
(GenBank) Propanoyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00071  Fatty acid degradation
dbr00072  Synthesis and degradation of ketone bodies
dbr00280  Valine, leucine and isoleucine degradation
dbr00310  Lysine degradation
dbr00362  Benzoate degradation
dbr00380  Tryptophan metabolism
dbr00620  Pyruvate metabolism
dbr00630  Glyoxylate and dicarboxylate metabolism
dbr00640  Propanoate metabolism
dbr00650  Butanoate metabolism
dbr00900  Terpenoid backbone biosynthesis
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
dbr01120  Microbial metabolism in diverse environments
dbr01130  Biosynthesis of antibiotics
dbr01200  Carbon metabolism
dbr01212  Fatty acid metabolism
dbr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deba_0969
   00630 Glyoxylate and dicarboxylate metabolism
    Deba_0969
   00640 Propanoate metabolism
    Deba_0969
   00650 Butanoate metabolism
    Deba_0969
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Deba_0969
   00072 Synthesis and degradation of ketone bodies
    Deba_0969
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Deba_0969
   00310 Lysine degradation
    Deba_0969
   00380 Tryptophan metabolism
    Deba_0969
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Deba_0969
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Deba_0969
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Deba_0969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dbr04147]
    Deba_0969
Enzymes [BR:dbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Deba_0969
Exosome [BR:dbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deba_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: ADK84339
UniProt: E1QFK3
Position
1080459..1081625
Genome map
AA seq 388 aa AA seqDB search
MREVAVIGVGMTKFGVSDKTNIELFSQAALEAIGEAGLEPGDMEALFFGNCLGDFEEGQL
HMAPFAAAAIGMPTTAPATRFEAACATATVAMRHAVLLVAAGVYDVALVGGAERCLRMGT
DLATRAFAMASDAYYEGPTGVTFPAVFAMATHMYAAKHGVELSELKRCMAEVSVKNHRHG
ALNPLAQFQKEIDLDKVLKGPMIADPLQLFDCCPFSDGATACVVVAAERAKAAPKQPIWV
AGMGQASAGPLYAQGDLTRVRAREAAVAASYKQAGLTAADIDVVELHDCFTIAEILALEA
LGFYEFGQGYAAAAKGETTFGGKVVVNPSGGLKAKGHPIGATGTGQVYEIVKQLRGECGP
RQVAGAKVGMVDTLGGDLGTVCNLILRS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagttgccgtcattggcgtggggatgaccaagttcggcgtctccgacaagacc
aacatagagttgttcagccaggccgccctggaggccattggcgaggccgggttggagccc
ggcgacatggaggcgttgtttttcggcaactgcctgggcgatttcgaggagggccaactg
cacatggcgcctttcgcggcggcggccatcggcatgccgacgacggccccggccacgcgt
ttcgaggcggcctgcgccacggccacggtggccatgcgtcacgcggtgctgttggtggcg
gcgggggtttatgacgtggccttggttggcggggcggagcgctgcctgcgcatgggcacc
gatctggccacccgcgccttcgccatggcttccgacgcctattacgaaggccccacgggc
gtgactttcccggctgttttcgccatggccacgcacatgtacgcggccaagcacggcgtg
gagttgagcgaactaaagcgttgcatggccgaggtttcggtgaaaaaccaccgccatggc
gcgttgaatccgctggcgcagttccagaaggagatcgacctcgacaaggttctgaagggg
ccgatgatcgccgatccgctgcaacttttcgattgctgcccgttttccgacggagccacg
gcctgcgtggtggttgcggccgaaagggccaaggccgcgcccaagcagccgatatgggtg
gccggcatgggccaggccagcgccgggccgctctacgcccagggcgatctgacccgcgtg
cgcgcccgcgaggcggcggtggcggcttcttacaagcaggccggcctgactgcggcggac
atcgatgtggtcgagctgcacgactgcttcaccatcgccgagatattggccctggaggcg
ctgggcttttacgagttcggccagggctacgcggcggcggccaagggcgagacgaccttt
ggcggcaaggtggtggtcaacccctcgggcgggctcaaggccaaggggcaccccatcggg
gccacgggcacgggccaggtctacgagatcgtcaagcagttgcgcggcgagtgcggcccg
cgccaggtggcgggggccaaggtgggcatggtcgacacgctgggcggcgatctgggcacg
gtttgcaatttgattctgaggagttga

DBGET integrated database retrieval system