KEGG   Desulfarculus baarsii: Deba_1359Help
Entry
Deba_1359         CDS       T01284                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00260  Glycine, serine and threonine metabolism
dbr00750  Vitamin B6 metabolism
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
dbr01120  Microbial metabolism in diverse environments
dbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deba_1359
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Deba_1359
Enzymes [BR:dbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Deba_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ADK84727
UniProt: E1QGN4
Position
1525162..1526664
Genome map
AA seq 500 aa AA seqDB search
MRPEQFAPQDQERLLPTPGGQMAYRCLGCGGHHGIEKLLYTCPNCGQVLLIEDRAFDRLK
ALDGPGWRRIFDLRRMLNIPALKGVFRYAELLAPVIPLDSVLYLGEGHTPIVEASPLLKQ
TLGLDFAFKNDGQNPSASFKDRGMAVALSYINYLIKHRGAGQILSICASTGDTSAAAALY
GAYLAPAVKSAVLLPRGKVTPQQLSQPLGAGAAVLEIPGVFDDCMKVVEHLADNYQVALL
NSKNAWRILGQESYAYELAQDLDWDMTGRLVLAPIGNAGNISAIMSGFMKLLDLGVITSL
PKIIGVQSHHADPVFQYYQQSSPEKRVWRPVTVQASTAQAAMIGNPVSMPRVIELARRYD
DLFGGGGFYVVQVSEQQIMDHMILANRHGHIVCTQGGESLAGLAQARAAGLVGASERAIC
DATAHQLKFAGFQQMYFENSFPAEFGVSPRPELVNMPQLVAALPEEQLPAPGRPLEPQAF
RRFVEATSDAVAARLGLEKK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccagaacaattcgcgccccaggatcaggagcgcctgctgcccacgcccggcggc
cagatggcctatcgctgtctgggctgcggcggccatcacggcatcgaaaagctgctctac
acctgccccaactgcggccaggtgctgctcatcgaagaccgcgccttcgaccgcctcaag
gccctggacggccctggctggcggcggatcttcgacctgcggcgcatgctcaacatcccc
gcgctcaagggcgttttccgctacgccgagttgctggccccggtcatcccgctggattcg
gtgctctatctgggcgagggccacacgcccatcgtcgaggccagccccttgctcaagcag
accctgggcctggatttcgcctttaaaaacgatggccagaaccccagcgcctcgttcaag
gaccggggcatggccgtggcgctgagctacatcaattatctgatcaagcatcgtggcgcg
ggccagatcctcagcatctgcgccagcaccggcgacacttcggcggcggcggccctttac
ggggcgtatctggccccggcggtcaaaagcgcggtgctgctgccccggggcaaggtcacg
ccccagcaactcagccagccgctgggcgcgggcgcggcggtgctggagatccctggcgtg
ttcgacgattgcatgaaggtcgtcgagcacctggccgacaactaccaggtggccctgctc
aattccaaaaacgcctggcgcatcctgggccaggagtcctacgcctacgaactggcccaa
gacctggactgggacatgaccggccggttagtgctggcgcccatcggcaacgccggcaac
atcagcgccatcatgagcggcttcatgaagctgctggacctgggcgtgatcacgtcgctg
cccaagatcatcggcgtgcagagccaccatgccgatccagtttttcaatattatcagcaa
tcttcgcccgaaaaacgcgtctggcggccggtgaccgtgcaggcttccacggcccaggcg
gccatgatcggcaaccccgtgtccatgcccagggtgatcgaactggcccggcgctacgac
gatctttttggcggcggcggtttttacgtggtgcaggtcagcgagcagcagatcatggac
cacatgatcctggccaatcgccacggccacatcgtctgcacccagggcggcgaatccctg
gccggcctggcccaggcccgggccgccggcctggtcggagcgagcgaacgggccatctgc
gacgccaccgcccatcaactcaagttcgccggcttccagcagatgtatttcgaaaacagc
ttcccggccgagttcggcgtcagcccccggccagagctggtcaacatgccccaactcgtg
gcggccctgcccgaggagcaactgcccgcgccgggccgacccctggagccacaggccttc
cgccgttttgtcgaggccacctccgacgccgtggccgcgcggctggggttggagaaaaaa
taa

DBGET integrated database retrieval system