KEGG   Desulfarculus baarsii: Deba_2980Help
Entry
Deba_2980         CDS       T01284                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00020  Citrate cycle (TCA cycle)
dbr00310  Lysine degradation
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
dbr01120  Microbial metabolism in diverse environments
dbr01130  Biosynthesis of antibiotics
dbr01200  Carbon metabolism
Module
dbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deba_2980
  Amino acid metabolism
   00310 Lysine degradation
    Deba_2980
Enzymes [BR:dbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Deba_2980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ADK86333
UniProt: E1QKX4
Position
3285803..3287065
Genome map
AA seq 420 aa AA seqDB search
MASDIVIPKLGMTMASAKLAAWKAAEGEWITEGQPVMVIETEKVTQDVEALADGFLHILA
APGAVAQVGEAVGQLAADEAELKALQAAAPAPEGLAAAPAAAPSAGEPAAPAAPGGRVKI
TPLAKKIARENGLDYRRLTGSGPGGRIKRADVERALKEGPPPAAEAPAAQSAAAWPGEVI
EGKRVKDSLPLSGIRAVIAEHMHKSLQNSAQLSAMGEFDVAELVRLRQSLIAHQEMIGAR
ISYTDLLVYIVARALKKNPLINSSVVGDQIKLWEDINIGVAVSLPMQKYDAGLIVPVIHD
ADKLSLTEISLRLKDLRRRCQEGTIGLEDLGGGTFTISNVGGFGQGYVFTTPIINQPQAA
ILGVGAILDRPVVQPDGQIGVGKLMNFSLTFDHRAINGAPIGLFLGTIQEMIKTPGLLLA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgatatcgtcatccccaagcttggcatgaccatggccagcgccaagctggcc
gcctggaaggccgccgaaggtgagtggatcaccgagggccagccggtgatggtcatcgaa
accgaaaaagtgacccaggacgtcgaggccctggccgacggatttttgcacatcctggcc
gcgccgggcgcggtggcccaggtcggcgaggccgtgggccaactggccgccgacgaggcc
gaactcaaggccctgcaagcggcggcccccgcccccgagggcctggccgccgcgccagcc
gccgcgccaagcgccggcgagccggccgccccggccgcgcccggcggtcgggtcaagatc
acgcccctggccaagaagatcgcccgcgaaaacggcctggactacaggcgcctcacgggc
agcggcccaggcgggcgcatcaaaagggccgacgtggagcgggccctgaaggaaggcccg
ccgcccgcggccgaggccccggccgcccagtcggccgccgcctggcccggcgaggtcatc
gagggcaagcgggtcaaggactcgctgccgctcagcggcatccgcgcggtcatcgccgag
cacatgcacaaaagcctgcaaaattcggcccagctttcggccatgggcgagtttgacgtg
gccgaactggttcgcctgcgccaatcgttgatcgcccaccaggagatgatcggcgcgcgg
atttcctacaccgatctgctggtctacatcgtggccagggcgctgaaaaaaaacccgctg
atcaactccagcgtggtcggcgatcagatcaagctgtgggaggacatcaacatcggcgtg
gccgtgagcctgcccatgcaaaaatacgacgccggcctgatcgtgccggtgatccacgac
gccgacaagctcagcctcaccgagatcagcctgcgcctgaaggacctgcgccggcgctgc
caggaggggaccatcggcctggaagacctcggcggcggcaccttcaccatctccaacgtc
ggcggctttggccagggctacgtcttcaccacgcccatcatcaaccagccccaggcggcg
atcttgggcgtgggggccatcctcgaccggccggtggtccagcccgacggccaaattggc
gtgggcaagctgatgaacttcagcctgaccttcgaccaccgggccatcaacggcgcgccc
atcggcttgttcctgggcacgatccaagagatgatcaagacgccgggcctgctgctggcc
tga

DBGET integrated database retrieval system