KEGG   Desulfarculus baarsii: Deba_3202Help
Entry
Deba_3202         CDS       T01284                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00010  Glycolysis / Gluconeogenesis
dbr00020  Citrate cycle (TCA cycle)
dbr00620  Pyruvate metabolism
dbr00633  Nitrotoluene degradation
dbr00640  Propanoate metabolism
dbr00650  Butanoate metabolism
dbr00680  Methane metabolism
dbr01100  Metabolic pathways
dbr01120  Microbial metabolism in diverse environments
dbr01130  Biosynthesis of antibiotics
dbr01200  Carbon metabolism
Module
dbr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deba_3202
   00020 Citrate cycle (TCA cycle)
    Deba_3202
   00620 Pyruvate metabolism
    Deba_3202
   00640 Propanoate metabolism
    Deba_3202
   00650 Butanoate metabolism
    Deba_3202
  Energy metabolism
   00680 Methane metabolism
    Deba_3202
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Deba_3202
Enzymes [BR:dbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Deba_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C NCOA_u2
Motif
Other DBs
NCBI-ProteinID: ADK86555
UniProt: E1QLX0
Position
complement(3544353..3545528)
Genome map
AA seq 391 aa AA seqDB search
MAQRVGLECSLAVSEAVKLANADVIAAYPITPQTHIVEHLSELVASGELDAEFVPVESEH
SAMSACVGSSAAGARTFTSSSSQGLALMHEILYIASALRLPIVMVVANRALSGPISIWND
HGDIMSERDINWVQFFAENGQEVLDLTITAFKIAEDHRVTLPVIVNMDGFILTHVIEPIE
MPEQNEVDAYLPPFVPAQKLDPAKPISMGMVGVPEVYTEARKACVDALEKSYPFIVEHWN
DFAAQFGRHYKPIECYKTDDAEALFVTMGSLSETAMTTVDELRAAGQKVGLVHIRLWRPF
PTDDFLAAIGESKPLMVLDRALSPGCNAGPVATELRALLYAKGKTHYVANFVAGLGGRDV
TRADFKSMMAKTLSAAKSGAPMPYEMVGVKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcgtgtggggcttgagtgctcactggccgttagcgaggccgtcaagcttgcc
aacgcggacgtgatcgcggcttatcccatcactccgcagacgcacattgtcgaacatctt
tccgagctggtggccagcggcgaactggacgccgagttcgtccccgtcgagagcgagcac
agcgccatgagcgcctgcgtgggctcgtcggcggccggcgcgcgcaccttcaccagctcc
agcagccagggcctggccctgatgcacgagatcctctacatcgccagcgccctgcgcctg
cccatcgtcatggtcgtggccaaccgcgccctcagcggccccatcagcatctggaacgac
cacggcgacatcatgagcgagcgcgacatcaactgggtgcagttcttcgccgaaaacggc
caggaggtgctggacctgaccatcaccgccttcaagatcgccgaggaccaccgcgtcacc
ctgccggtgatcgtcaacatggacggcttcatcctcacccacgtcatcgagcccatcgag
atgcccgagcaaaacgaggtcgacgcctatctgccgccctttgtcccggcccagaagctc
gatccggccaagcccatcagcatgggcatggtcggcgtgcccgaggtctacaccgaggcg
cgcaaggcctgcgtggacgccctggaaaaaagctatcccttcatcgtcgagcactggaac
gacttcgcggcccaattcggccggcactacaagcccatcgagtgttacaagaccgacgac
gccgaggcgcttttcgtgaccatgggctcgctgagcgagacggccatgaccacggtggat
gagctgcgcgccgccggccagaaggtgggcctggtgcacatccgcctgtggcggcctttc
ccgaccgacgacttcctggcggccatcggcgagagcaagccgctgatggtcctcgaccgg
gcgctcagccccggctgcaacgccgggccggtggccaccgagctgcgggccctgttgtac
gccaagggcaagacccattacgtggccaacttcgtggccggcctgggcggccgtgacgtc
acccgcgccgacttcaagtcgatgatggccaagaccctgtcggccgccaagtccggcgcg
ccgatgccctacgagatggtgggggtgaaggaatga

DBGET integrated database retrieval system