KEGG   Desulfotomaculum nigrificans: Desca_0127Help
Entry
Desca_0127        CDS       T01498                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00010  Glycolysis / Gluconeogenesis
dca00051  Fructose and mannose metabolism
dca00562  Inositol phosphate metabolism
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
dca01120  Microbial metabolism in diverse environments
dca01130  Biosynthesis of antibiotics
dca01200  Carbon metabolism
dca01230  Biosynthesis of amino acids
Module
dca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dca_M00002  Glycolysis, core module involving three-carbon compounds
dca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desca_0127
   00051 Fructose and mannose metabolism
    Desca_0127
   00562 Inositol phosphate metabolism
    Desca_0127
Enzymes [BR:dca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desca_0127
Exosome [BR:dca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desca_0127
  Exosomal proteins of bladder cancer cells
   Desca_0127
  Exosomal proteins of melanoma cells
   Desca_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEF93031
UniProt: F6B4K8
Position
131463..132215
Genome map
AA seq 250 aa AA seqDB search
MRQLIIAGNWKMHKNIHEAMEFLQELRGKLGSTPVEAVVCPPFTALAPVAEALKGSNIAL
GAQNMHWEKQGAYTGEVSPLMLREIGCKYVILGHSERRQYFGETDESVNKKVKAALEHGL
VPIICVGETLDQREAGITEQVVATQTTGALEGLTPGQVAGLVIAYEPVWAIGTGKTASEK
DAQQVNRYIRKVIADQYGAAAAEAVRIQYGGSVKPGNARALMSQPDIDGALVGGASLQVD
DFVGIIENSL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcggcagttaatcatcgccggaaactggaagatgcataaaaatattcacgaggcaatg
gagtttttgcaagaattgcgagggaaattgggcagcacaccggtggaagcggtggtatgc
ccgccctttaccgccctggcgccggtggccgaagccttaaagggcagcaacattgctctg
ggcgcccaaaacatgcactgggaaaagcaaggggcctataccggggaagtttcacccctt
atgctaagggagatcgggtgtaaatatgtcatcctgggccactcggaaagaaggcagtac
tttggagaaaccgacgagagtgttaacaaaaaagtgaaagcagccctggaacacggtctt
gttcccatcatctgtgtgggagagaccctggaccagcgggaagccggcatcaccgaacaa
gtggtggccacccagaccacaggggccctggagggtctgacccccgggcaggtggcgggc
ctggtcattgcctatgaaccggtctgggccatcggcaccggtaaaacagcctcggagaaa
gatgcccagcaggtcaaccgctacatccgtaaagtgattgccgaccaatacggcgctgct
gctgccgaggcggtgcgcatacaatatggcggcagtgtgaagcccggcaatgccagggcg
ttaatgtcgcagccggatatcgacggcgccctggtgggcggcgccagcctgcaagtggac
gactttgtcggtatcattgaaaactctctgtga

DBGET integrated database retrieval system