KEGG   Desulfotomaculum nigrificans: Desca_0564Help
Entry
Desca_0564        CDS       T01498                                 

Definition
(GenBank) phospholipase C zinc-binding protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00562  Inositol phosphate metabolism
dca00564  Glycerophospholipid metabolism
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
dca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Desca_0564
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Desca_0564
   00565 Ether lipid metabolism
    Desca_0564
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Desca_0564
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:dca02042]
    Desca_0564
Enzymes [BR:dca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     Desca_0564
Bacterial toxins [BR:dca02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   Desca_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_dep_PLPC
Motif
Other DBs
NCBI-ProteinID: AEF93454
UniProt: F6B7T2
Position
complement(615190..615885)
Genome map
AA seq 231 aa AA seqDB search
MSLTQTTWHCAKAMLTLTIPFQAIKSSRPRNTHRFCNLQAINILKRDGFRQEALLYHSFR
DALNRGAVWCDKGFKNISHYYNHQANSGLWHGPDAPTECQFYVNRAVKKWRQGRLSEAMF
YLGAAVHIIQDLCVPHHASGLVFGGHKFFEDWAREHYEDFTVNHGGIYDLADSGADWVIE
NAAVSATYLPQVINGNNSTAIAGVVEILLQRAQKTTAGFLLYFHRLTQFKK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgacacaaactacctggcactgcgccaaggctatgctcacattaacaatacct
tttcaggccataaaatcaagccgtcctagaaatacccaccgtttttgtaatctacaggct
attaatatactcaaaagagatggttttcgccaagaagcgttactttatcactcctttcgg
gacgctctaaatcgcggggccgtctggtgcgacaagggttttaaaaatattagtcattac
tacaatcaccaggccaacagcggactatggcacggtcctgatgcccccactgaatgtcaa
ttctatgtcaaccgggccgttaaaaagtggcggcagggtcgtttatcggaagctatgttt
tacctgggggccgccgttcatatcatccaggacctgtgtgtaccgcaccatgccagtggt
ttggtttttggcgggcacaaattttttgaggattgggccagggaacactatgaggatttt
accgttaaccacgggggtatttatgatctggctgacagtggcgccgactgggttatagag
aatgctgcggtgtctgctacttatttaccacaagtaataaacggaaacaactccacggcc
atcgccggtgtggtggaaatattactgcaaagagcccaaaaaacaacagccggttttctc
ctttatttccaccggctgactcagtttaaaaagtag

DBGET integrated database retrieval system