KEGG   Desulfotomaculum nigrificans: Desca_0604Help
Entry
Desca_0604        CDS       T01498                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00630  Glyoxylate and dicarboxylate metabolism
dca00660  C5-Branched dibasic acid metabolism
dca01100  Metabolic pathways
dca01120  Microbial metabolism in diverse environments
dca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Desca_0604
   00660 C5-Branched dibasic acid metabolism
    Desca_0604
Enzymes [BR:dca01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     Desca_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C Enolase_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AEF93494
UniProt: F6B849
Position
656954..658201
Genome map
AA seq 415 aa AA seqDB search
MKITGAAVSPGLTGFYFDDQKAIKMGREHDGFAYLGQPATPGFSSVRQRGESISVMLMLE
NGSVAYGDCAAVQYSGAGGRDPLFLAADFIPVLEKEVLPRLVGRDITGFRQLAEEFDHLK
HPDGSRFHTALRYGITQALLDAAARAAGCTMAEVVAKEYNCTLVDRQVPIFCQTGDDRYT
NADKIIIKRADVLPHGLINNVEEKLGRRGEKLLEYVSWLKDRAIRLGGENYRPVLHIDVY
GTIGQAFDDHTDRMADYLAQIEHAAYPFHIRIEGPMDRGSKPAQIEALAELRQTLKRRGI
KVEIVADEWCNTLEDIREFVDAGAGDMVQIKTPDLGGINNTIEAILYAKERGIGAYLGGT
CNETDRSAQVCVHIGIATQPDQMLAKPGMGVDEGLMIVYNEMNRTLALLRARGVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcactggtgctgctgtttcgccgggacttaccggcttttactttgacgaccaa
aaggccattaagatgggacgggagcatgacggttttgcctatctggggcaaccggccacc
ccgggctttagctctgtgcgccagcggggcgagtcaatttctgtcatgctgatgctggaa
aacggctccgtggcttacggggattgtgccgcggtgcaatattccggggccggcgggcgg
gacccgctgttcctggccgctgatttcattcctgtgttggaaaaagaggtgctgcctaga
ctggtgggacgggatattaccggcttccggcaattggcagaggaatttgatcatctgaag
cacccggacggcagccgtttccataccgccctgcgctatggtatcacccaggccctgctg
gacgccgctgcccgggccgccggctgcaccatggccgaagtggtggccaaagaatataac
tgtaccctggtggaccggcaagtacccattttctgccaaaccggggacgatcgttatacc
aacgctgataaaatcattattaaacgggcggacgtattaccccacgggttaattaataat
gtggaggaaaagctgggccgccgcggggaaaaactgctggagtatgtgtcctggctgaag
gaccgggccatccggttaggcggtgaaaattaccggcctgttttacatatcgatgtttac
ggcaccatcggacaagcttttgatgatcacaccgaccgcatggccgattacctggcgcaa
attgagcatgcagcttaccccttccacatccgtattgaggggccgatggaccggggcagt
aagccggcccagattgaggccctggctgaactgcggcagaccttaaagcgccggggcatt
aaggtagaaatagtggccgatgagtggtgtaacacactggaggatatccgggaatttgtg
gatgccggggccggggatatggtgcaaatcaaaaccccggatttaggcggtatcaataac
accattgaagctatcctttatgccaaggaacggggcattggcgcctacctgggtggcacc
tgcaacgaaaccgaccgttcggcccaggtttgtgtgcatatcggtattgccacccagccg
gatcaaatgctggccaaacccggcatgggtgtggacgagggcctgatgattgtctataac
gaaatgaaccgtaccctggcactgctcagggccagaggggttgtgtaa

DBGET integrated database retrieval system