KEGG   Desulfotomaculum nigrificans: Desca_1697Help
Entry
Desca_1697        CDS       T01498                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00010  Glycolysis / Gluconeogenesis
dca00030  Pentose phosphate pathway
dca00051  Fructose and mannose metabolism
dca00052  Galactose metabolism
dca00680  Methane metabolism
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
dca01120  Microbial metabolism in diverse environments
dca01130  Biosynthesis of antibiotics
dca01200  Carbon metabolism
dca01230  Biosynthesis of amino acids
dca03018  RNA degradation
Module
dca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desca_1697
   00030 Pentose phosphate pathway
    Desca_1697
   00051 Fructose and mannose metabolism
    Desca_1697
   00052 Galactose metabolism
    Desca_1697
  Energy metabolism
   00680 Methane metabolism
    Desca_1697
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desca_1697
Enzymes [BR:dca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desca_1697
Protein phosphatases and associated proteins [BR:dca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desca_1697
Messenger RNA biogenesis [BR:dca03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Desca_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEF94545
UniProt: F6B7J1
Position
complement(1820395..1821357)
Genome map
AA seq 320 aa AA seqDB search
MQRIGVLTSGGDASGMNSCIRAVVRKAIYHGIEVIGIKRGYSGFIEAEMYPMNLGSVADI
IHRGGTILHTARSERFKTKEGRALAMENVQRFGIQGLVVIGGDGSFTGASIFHQEYGIPV
ICVPGTIDNDIAGTDYTIGFDTAVNNVVDAINKIRDTATSHERTFVIEVMGRGSGNIALA
AGLAGGAESILIPEIPFNVQDICHKLLSGLKRGKLHSIILVAEGAASGLEIGKQIKELTG
LDTKVTILGHLQRGGIPTAFDRTLAARLGAKAVELLKDGETNKMVGIKSGEIVATDLTEV
IGQPKSIDKEMYELAKILSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaggattggtgtcttaacaagtggcggggatgcctcgggaatgaactcctgtatt
cgagcagtggtccgtaaagccatttatcacggtattgaagtcatagggattaagcgtggt
tatagtggattcattgaagcggaaatgtatccgatgaatctcggttcggtggctgacatt
atacataggggcggcacaattctccataccgcccggtcagaacgctttaagactaaggaa
ggtcgggctctggccatggaaaatgtgcagcgttttggtattcaaggtttggttgttatt
ggcggtgacggctcctttaccggtgccagtatttttcaccaggaatatggtatcccggtg
atttgtgtgcccggtaccattgataatgatattgccggcactgattataccattggtttt
gatactgccgttaacaatgtggttgatgccatcaacaaaatcagagatactgctacctcc
catgagcgcacctttgtcattgaagtgatgggccgtggatcgggtaatattgccctggcc
gccggtttagccggcggtgcggagagcatcctgattcctgaaataccttttaatgtgcaa
gatatttgccacaagctgttgagtggtttaaaaagaggtaaattacactccataatttta
gtggctgaaggtgccgccagtgggctggaaataggtaagcaaattaaggagttaaccggt
cttgataccaaggttactattctgggccatttgcaaagagggggaattcccactgccttt
gaccgtactctggcggccaggttgggagctaaggcagtggagctgttaaaagacggagaa
actaacaaaatggttggtattaagtcaggagaaattgtggccaccgatctaacggaagta
atcggccaacccaagtcaatagataaagaaatgtatgagctggctaaaatactttctatt
taa

DBGET integrated database retrieval system