KEGG   Desulfotomaculum nigrificans: Desca_1861Help
Entry
Desca_1861        CDS       T01498                                 

Definition
(GenBank) Glycyl-tRNA synthetase beta subunit
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desca_1861
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dca01007]
    Desca_1861
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dca03016]
    Desca_1861
Enzymes [BR:dca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Desca_1861
Amino acid related enzymes [BR:dca01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Desca_1861
Transfer RNA biogenesis [BR:dca03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Desca_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AEF94705
UniProt: F6B8E1
Position
complement(1976840..1978924)
Genome map
AA seq 694 aa AA seqDB search
MAKDFLLEIGIEEMPARFLAPALAQLKELTAKTLQEQRIVYGDIATYGTPRRLVLYVKDA
AEDQAPLEKEVKGPAKKAAFDIDGNPTKAIQGFMRSQGVSLEDLVVRHIGQVEYLYAVKR
EAGRPTADVLAEICPALITGLHFPKPMRWGSLEMRFARPIRWLLALFGDDVVPFELANLK
SNRITYGHRFLTTGDLPIANPADYFDRIRKAYVLIDPVERKEVIRQQVQELAAAEGGQVE
MDEDLLDEITNIVEWPTALCGSFDRDYLKLPAAVLVTPMREHQRYFPVLGPDGQLLNKFI
AVRNGTKAYLDIVTAGNEKVLRARLADAAFFFEEDLKKPLASKVDGLKKVVFLEGLGTVA
DKVDRIGALADHLAELLGADEQQQEKIQRAALLAKADLVTNMVYEFPELQGVMGREYALR
NGEDPDVAEAIFQHYLPRFAGDQLPNTLAGRVLSLADKMDTIVGCFAIGIQPTGSADPYA
LRRQALGICHIITEGNLHLSLKQMIEWAYQGYSAEVELKYTLPQVTGEIEEFFKQRIKGM
MSDRGLSYDTVEAVLAVGFDDITDAFARGAALTSFRDQPAFNALMTAFNRANNLAKNATG
GAINEAYLEHPAEHELYRQLTALTQKVQPLIQSRDYVAALREIAAIQAPLNEFFEQVMVM
VEDERIKTNRLALLKNLVDLSKTVADFSKVVLEG
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggactttttactggagattggcatagaagaaatgccggcccgctttctggcc
ccggctttggcccaattaaaggaattaaccgccaaaaccctgcaggaacaaagaatcgtc
tatggtgatattgccacctacggcacgccccggcggctggtgctgtacgtaaaagatgcg
gctgaagaccaggctcccctggaaaaagaagtgaaggggccggccaaaaaggcggccttt
gatattgacggtaatcctaccaaagccattcaaggctttatgcgctcccagggggttagt
ttagaagacctggtggtgcgccatatcggccaggtggaatacctgtatgccgttaagcgg
gaagcaggccgacccaccgccgatgttctggcggagatttgccccgccctgattaccgga
ctgcatttccccaaacccatgcgctggggttccctggaaatgcgttttgcccgtcccatt
cgctggctgttagccttgtttggtgatgatgtggtgccctttgaactggctaacctgaag
tcaaatagaattacctacgggcatcggttcctaaccaccggggatttgcccattgccaat
ccggcggattactttgaccggattagaaaagcatatgtgctcattgacccggtggaacgc
aaggaggttatccggcagcaggtgcaggaactggcggcggccgaaggcggtcaggtggaa
atggacgaagacctgctggacgagatcactaatatcgttgaatggcccaccgccctctgc
ggcagtttcgaccgggattatcttaaattacccgcggcggtgctggtcacccctatgcgg
gaacaccagcggtacttcccggtgctgggaccggacggtcaacttttaaataaatttatt
gctgtgagaaacggtactaaagcttatttagatattgtcaccgccggtaacgaaaaggtt
ttacgggcccgcctggccgatgctgccttcttctttgaagaagatttgaaaaagccactg
gccagtaaagttgatggtctaaagaaagtggtattcttggaaggtttgggtaccgtggcg
gataaagttgaccgcattggggccctggccgaccacctggcggaattgctgggtgctgat
gaacaacaacaagaaaaaattcagcgggccgctctgttggctaaagcggacctggtaacc
aatatggtgtatgaattccccgagctgcagggggttatggggcgggaatatgccctgcgt
aacggcgaagatccggatgtggccgaggccatcttccagcattacctgccccgttttgcc
ggtgaccaactgccgaacaccctggccggccgggtattaagcctggctgataagatggac
accattgtaggttgttttgccatcggcatccagcccaccgggtccgccgacccctatgcg
ctgcgtcggcaggccctgggtatttgccacattatcaccgaaggaaatctccacctgtcc
ctcaagcaaatgattgagtgggcctaccagggatacagtgcagaggtagaactaaaatac
actttgccccaggttaccggcgagattgaagaattctttaaacaacggattaaaggcatg
atgagcgaccggggcctgtcctatgacaccgtggaggcagttttagctgtgggatttgat
gatataaccgatgcctttgccagaggtgcagccctcacttccttccgggaccagcccgcc
tttaacgccctgatgactgccttcaaccgggccaataacctggccaaaaacgccaccggc
ggagctatcaatgaggcctacttagagcacccggcagagcatgagttataccggcaatta
actgccctaacccaaaaggtgcagccccttattcaaagccgggactatgtggcggcccta
agggaaattgccgccatccaggccccgctcaatgagttctttgaacaggtaatggtgatg
gtggaggatgagagaataaaaaccaaccgcctggccctgttaaagaatttagtggattta
agcaaaaccgtagcagatttcagcaaggttgtgctggaagggtaa

DBGET integrated database retrieval system